• Featured Product
  • KD/KO Validated

CX3CR1 Polyclonal antibody

CX3CR1 Polyclonal Antibody for WB, IP, ELISA
Cat No. 13885-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA, Cell treatment

CMK BRL1, CMK BRL 1, CCRL1, C X3 C CKR 1, Beta chemokine receptor-like 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HL-60 cells, HEK-293 cells, SH-SY5Y cells, U-937 cells, K-562 cells
Positive IP detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13885-1-AP targets CX3CR1 in WB, IHC, IF, IP, CoIP, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4149

Product name: Recombinant human CX3CR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 254-355 aa of BC028078

Sequence: ETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

Predict reactive species
Full Name chemokine (C-X3-C motif) receptor 1
Calculated Molecular Weight 40 kDa
Observed Molecular Weight 44-47 kDa
GenBank Accession NumberBC028078
Gene Symbol CX3CR1
Gene ID (NCBI) 1524
RRIDAB_2087418
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49238
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CX3CR1, also known as GPR13, V28 and fractalkine receptor, belongs to the 7-transmembrane G protein-coupled receptor (GPCR) family. It is expressed on microglia, astrocytes, NK cells, monocytes/macrophages, and a subpopulation of T cells. CX3CR1 is the receptor for fractalkine (CX3CL1) and mediates both its adhesive and migratory functions. It also acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro), and some variations in the gene of CX3CR1 lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Defects in CX3CR1 are a cause of susceptibility to age-related macular degeneration type 12 (ARMD12).

Protocols

Product Specific Protocols
WB protocol for CX3CR1 antibody 13885-1-APDownload protocol
IP protocol for CX3CR1 antibody 13885-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIP

Brain

Reactive microglia enhance the transmission of exosomal alpha-synuclein via toll-like receptor 2.

Authors - Yun Xia
humanWB,IF

Tissue Cell

Analysis of Aβ-induced neurotoxicity and microglial responses in simple two- and three-dimensional human iPSC-derived cortical culture systems

Authors - Mayuko Takata
mouseWB

J Control Release

Chemoattractants driven and microglia based biomimetic nanoparticle treating TMZ-resistant glioblastoma multiforme.

Authors - Sai Qiao
mouseIHC

Front Immunol

Myeloid-derived growth factor promotes M2 macrophage polarization and attenuates Sjögren's syndrome via suppression of the CX3CL1/CX3CR1 axis

Authors - Zi Yang
mouseWB

Nanoscale

Calming egress of inflammatory monocytes and related septic shock by therapeutic CCR2 silencing using macrophage-derived extracellular vesicles.

Authors - Liang Ding
humanWB

Mol Oncol

Platelets are recruited to hepatocellular carcinoma tissues in a CX3CL1-CX3CR1 dependent manner and induce tumour cell apoptosis.

Authors - Shuo Miao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Reyes (Verified Customer) (03-01-2024)

Cx3cr1 antibody (in red) tried on human paraffin brain sections, apparently vesicular while marking my microglia.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Human Brain Cortex
CX3CR1 Antibody Immunofluorescence validation (1:100 dilution) in Human Brain Cortex (Cat no:13885-1-AP)
FH

Ryan (Verified Customer) (06-15-2018)

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: zebrafish retina
Loading...
||
New chat Able
正在加载,请稍候...