Tested Applications
| Positive WB detected in | IFN gamma, LPS and Brefeldin A treated THP-1 cells |
| Positive IHC detected in | human hepatocirrhosis tissue, human liver cancer tissue, human nasopharyngeal carcinoma tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10937-1-AP targets CXCL10/IP-10 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1369 Product name: Recombinant human CXCL10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC010954 Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 10 |
| Calculated Molecular Weight | 11 kDa |
| Observed Molecular Weight | 11 kDa |
| GenBank Accession Number | BC010954 |
| Gene Symbol | CXCL10 |
| Gene ID (NCBI) | 3627 |
| RRID | AB_2088002 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P02778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXCL10/IP-10 antibody 10937-1-AP | Download protocol |
| WB protocol for CXCL10/IP-10 antibody 10937-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-CXCL10 (IP-10) Monoclonal Antibody (Cat# 10937-1-AP) has 84 citations published in journals including Nature Communications, Cell Research, Science Advances, Cell Reports, Journal for ImmunoTherapy of Cancer, Frontiers in Immunology, CNS Neuroscience & Therapeutics, Journal of Ethnopharmacology, and FASEB Journal. Associated research fields span oncology (hepatocellular, lung, colorectal, pancreatic cancers), tumor immunology and immune microenvironment, neurology (neuropathic pain, spinal cord injury, Alzheimer's disease), dermatology (vitiligo), hepatology (NASH, liver injury), and autoimmune/inflammatory diseases.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Ultra-high dose rate radiotherapy overcomes radioresistance in head and neck squamous cell carcinoma | ||
Cell Res Glucose starvation mimetic aldometanib removes immune barriers permitting mice with hepatocellular carcinoma to live to normal ages. | ||
Cancer Commun (Lond) KRAS-G12D mutation drives immune suppression and the primary resistance of anti-PD-1/PD-L1 immunotherapy in non-small cell lung cancer. | ||
Bioact Mater Microenvironment-educated MSC-EVs loaded injectable smart hydrogel for targeting senescent nucleus pulposus cells and inhibiting ferroptosis against intervertebral disc degeneration. | ||
Nat Commun A single-cell atlas of the multicellular ecosystem of primary and metastatic hepatocellular carcinoma. | ||
J Nanobiotechnology Microneedles combining delivery of hUMSC-derived exosomes and EGCG mitigate UV-induced skin damage. |
Reviews
What customers say
One customer rated this antibody 5 stars for IHC on healthy lymphonode tissue at a 1:200 dilution. They used an Alkaline Phosphatase Dako kit with Antigen Retrieval PH10 and reported satisfactory results. The review was posted in November 2023.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Federica (Verified Customer) (11-07-2023) | I used Alkaline Phospatase Dako kit and Antigen Retrival PH10
 |
