• Featured Product
  • KD/KO Validated

CXCL10/IP-10 Polyclonal antibody

CXCL10/IP-10 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10937-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

CXCL10, CXCL10/IP10, IP10, 10 kDa interferon gamma-induced protein, C X C motif chemokine 10

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inIFN gamma, LPS and Brefeldin A treated THP-1 cells
Positive IHC detected inhuman hepatocirrhosis tissue, human liver cancer tissue, human nasopharyngeal carcinoma tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10937-1-AP targets CXCL10/IP-10 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1369

Product name: Recombinant human CXCL10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-98 aa of BC010954

Sequence: MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 10
Calculated Molecular Weight 11 kDa
Observed Molecular Weight11 kDa
GenBank Accession NumberBC010954
Gene Symbol CXCL10
Gene ID (NCBI) 3627
RRIDAB_2088002
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02778
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL10 (also known as IP-10) is a member of the CXC chemokine family which binds to the CXCR3 receptor to exert its biological effects. CXCL10 is a 12-kDa protein and constitutes two internal disulfide cross bridges. The predicted signal peptidase cleavage generates a 10-kDa secreted polypeptide with four conserved cysteine residues in the N-terminal. The CXCL10 gene localizes on chromosome 4 at band q21, a locus associated with an acute monocytic/B-lymphocyte lineage leukemia exhibiting translocation of t (4; 11) (q21; q23). CXCL10 mediates leukocyte trafficking, adaptive immunity, inflammation, haematopoiesis and angiogenesis. Under proinflammatory conditions CXCL10 is secreted from a variety of cells, such as leukocytes, activated neutrophils, eosinophils, monocytes, epithelial cells, endothelial cells, stromal cells (fibroblasts) and keratinocytes in response to IFN-γ.

Protocols

Product Specific Protocols
WB protocol for CXCL10/IP-10 antibody 10937-1-APDownload protocol
IHC protocol for CXCL10/IP-10 antibody 10937-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancer Lett

PARP inhibitor plus radiotherapy reshape the immune suppressive microenvironment and potentiate the efficacy of immune checkpoint inhibitors in tumors with IDH1 mutation

Authors - Xiaoyu Hu
humanIHC

J Mater Chem B

Magnetic hyperthermia induces effective and genuine immunogenic tumor cell death with respect to exogenous heating

Authors - Bin Yan
mouse,humanIHC

Front Immunol

LRPPRC facilitates tumor progression and immune evasion through upregulation of m6A modification of PD-L1 mRNA in hepatocellular carcinoma

Authors - Houhong Wang
humanIHC

Cancer Commun (Lond)

KRAS-G12D mutation drives immune suppression and the primary resistance of anti-PD-1/PD-L1 immunotherapy in non-small cell lung cancer.

Authors - Chengming Liu
mouseIF

CNS Neurosci Ther

Melatonin Alleviates Behavioral and Neurodevelopmental Abnormalities in Offspring Caused by Prenatal Stress

Authors - Dong Wu
humanIHC

Am J Cancer Res

Identification of potential immune-related circRNA-miRNA-mRNA regulatory network in cutaneous squamous cell carcinoma

Authors - Yuanfeng Wei

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Federica (Verified Customer) (11-07-2023)

I used Alkaline Phospatase Dako kit and Antigen Retrival PH10

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Healthy Lymphonode
CXCL10/IP-10 Antibody Immunohistochemistry validation (1:200 dilution) in Healthy Lymphonode (Cat no:10937-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...