CXCR3 Polyclonal antibody

• 

  WB analysis of HepG2 using 26756-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26756-1-AP (CXCR3 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 26756-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26756-1-AP (CXCR3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 26756-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26756-1-AP (CXCR3 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 26756-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 26756-1-AP (CXCR3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

CXCR3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26756-1-AP

Publications(19)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

C-X-C chemokine receptor type 3, CMKAR3, CKR-L2, CKR L2, CD183

---

Tested Applications

• Positive WB detected in: HepG2 cells, Jurkat cells, mouse liver tissue
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IHC: See 4 publications below
• IF: See 8 publications below

Product Information

26756-1-AP targets CXCR3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25056

  Product name: Recombinant human CXCR3 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-53 aa of BC034403

  Sequence: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR

• Full Name: chemokine (C-X-C motif) receptor 3
• Calculated Molecular Weight: 368 aa, 41 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC034403
• Gene Symbol: CXCR3
• Gene ID (NCBI): 2833
• RRID: AB_2880623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P49682
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCR3 (C-X-C chemokine receptor type 3) is a G-protein-coupled seven-transmembrane domain chemokine receptor that is expressed on the surface of a number of cell types, including activated CD4+ and CD8+ T cells, NK and NK-T cells, plasmacytoid dendritic cells, and some B cells. CXCR3 is activated by three related chemokines (CXCL9, CXCL10, and CXCL11) and plays an important role in effector T-cell and NK cell trafficking. CXCR3 has three isoforms termed CXCR3-A, CXCR3-B, and CXCR3-alt with the calculated molecular mass of 41kDa, 46kDa, and 29kDa respectively. The apparent molecular mass of CXCR3 detected by some scientists is 70kDa, but 45kDa by others. (PMID: 16847335, 15150261, 22885102, 19151743)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Bioeng Transl Med; Therapeutic potential of nanoceria pretreatment in preventing the development of urological chronic pelvic pain syndrome: Immunomodulation via reactive oxygen species scavenging and SerpinB2 downregulation; Authors - Wei-Chih Lien
human	WB	J Cell Sci; Gap junction-mediated MiR-200b on osteogenesis and angiogenesis in coculture between MSCs and HUVECs.; Authors - Xiaoting Fan
human	WB	J Immunol; A Novel TrxR1 Inhibitor Regulates NK and CD8+ T Cell Infiltration and Cytotoxicity, Enhancing the Efficacy of Anti-PD-1 Immunotherapy against Hepatocarcinoma; Authors - Xiaoxia Su
mouse	WB,IF	Front Pharmacol; Paeonol Ameliorates Chronic Itch and Spinal Astrocytic Activation via CXCR3 in an Experimental Dry Skin Model in Mice.; Authors - Wen Wang
human,mouse	IF	Front Endocrinol (Lausanne); Induction of Collagen I by CXCL10 in Ovarian Theca-Stroma Cells via the JNK Pathway.; Authors - Chaojun Wang
human	WB	Autoimmunity; CXCL4 promoted the production of CD4+CD25+FOXP3+treg cells in mouse sepsis model through regulating STAT5/FOXP3 pathway.; Authors - Tao Xu