• Featured Product
  • KD/KO Validated

Cytoglobin Polyclonal antibody

Cytoglobin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13317-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CYGB, EC:1.11.1.-, EC:1.14.12.-, EC:1.15.1.1, EC:1.7.-.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, human heart tissue, human uterus tissue, mouse brain tissue, mouse kidney tissue, mouse lung tissue, mouse small intestine tissue, mouse spleen tissue, mouse stomach tissue, PC-3 cells, rat kidney tissue, Transfected HEK-293 cells
Positive IHC detected inhuman liver cancer tissue, human heart tissue, human liver tissue, human prostate cancer tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13317-1-AP targets Cytoglobin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4161

Product name: Recombinant human CYGB protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-190 aa of BC029798

Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

Predict reactive species
Full Name cytoglobin
Calculated Molecular Weight 190 aa, 21 kDa
Observed Molecular Weight 21-29 kDa
GenBank Accession NumberBC029798
Gene Symbol Cytoglobin
Gene ID (NCBI) 114757
RRIDAB_2090645
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8WWM9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytoglobin, also named as Histoglobin, HGb, STAP and CYGB, belongs to the globin family. Cytoglobin may have a protective function during conditions of oxidative stress. It may be involved in intracellular oxygen storage or transfer. It serves as a defensive mechanism against oxidative stress both in vitro and in vivo.(PMID:21224051) Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kd, runs as a 29kd one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.

Protocols

Product Specific Protocols
IF protocol for Cytoglobin antibody 13317-1-APDownload protocol
IHC protocol for Cytoglobin antibody 13317-1-APDownload protocol
WB protocol for Cytoglobin antibody 13317-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
rat,mouse,humanWB,IF

Arterioscler Thromb Vasc Biol

The Hemoglobin Homolog Cytoglobin in Smooth Muscle Inhibits Apoptosis and Regulates Vascular Remodeling.

Authors - Frances L Jourd'heuil
  • KD Validated
humanWB

Antioxid Redox Signal

The anti-oxidative role of cytoglobin in podocytes: implications for a role in chronic kidney disease.

Authors - Elisa B Randi
humanWB

Antioxidants (Basel)

Cytoglobin Silencing Promotes Melanoma Malignancy but Sensitizes for Ferroptosis and Pyroptosis Therapy Response

Authors - Joey De Backer
  • KD Validated
mouseIHC

J Cell Physiol

Integrative proteomics and immunochemistry analysis of the factors in the necrosis and repair in acetaminophen-induced acute liver injury in mice.

Authors - Qin Feng
humanWB

Mol Med Rep

Intranasal administration of Cytoglobin modifies human umbilical cord‑derived mesenchymal stem cells and improves hypoxic‑ischemia brain damage in neonatal rats by modulating p38 MAPK signaling‑mediated apoptosis.

Authors - Hanhua Yang
humanWB

Vascul Pharmacol

Endothelial cell-induced cytoglobin expression in vascular smooth muscle cells contributes to modulation of nitric oxide.

Authors - Brenda Lilly
Loading...
||
New chat

Able

正在加载,请稍候...