CYP2D6/7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYP2D6/7 Polyclonal antibody (17868-1-AP)

CYP2D6/7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17868-1-AP Copied!

Publications (14)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CYP2D6, Cholesterol 25-hydroxylase, CYP2DL1, CYPIID6, Cytochrome P450 2D6

• 

  WB analysis using 17868-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17868-1-AP (CYP2D6/7 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 17868-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 17868-1-AP (CYP2D6 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17868-1-AP (CYP2D6 antibody) at dilution of 1:600 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17868-1-AP (CYP2D6 antibody) at dilution of 1:600 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17868-1-AP (CYP2D6 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 17868-1-AP (CYP2D6 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17868-1-AP (CYP2D6 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17868-1-AP (CYP2D6 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17868-1-AP (CYP2D6 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17868-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17868-1-AP (CYP2D6 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP2D6/7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver cancer tissue, human liver tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:200-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17868-1-AP targets CYP2D6/7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12351

  Product name: Recombinant human CYP2D6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 148-497 aa of BC075023

  Sequence: SLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR

• Full Name: cytochrome P450, family 2, subfamily D, polypeptide 6
• Calculated Molecular Weight: 497 aa, 56 kDa
• Observed Molecular Weight: 48-56 kDa
• GenBank Accession Number: BC075023
• Gene Symbol: CYP2D6
• Gene ID (NCBI): 1565
• RRID: AB_2878457
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10635
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CYP2D6(Cytochrome P450 2D6) is also named as CYP2DL1 and belongs to the cytochrome P450 family. It is a monooxygenase that involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants. CYP2D6 is responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It has 2 isoforms produced by alternative splicing with the molecular weight of 56 kDa and 50 kDa. This antibody can recognize human CYP2D6/7, mouse CYP2D3/4/9/10/22/26, rat CYP2D1/3/4/10/26, due to the high homology.

Publications

What published studies show

The CYP2D6/7 Polyclonal antibody (Cat# 17868-1-AP) has 14 citations published in journals including J Adv Res, Theranostics, Biochem Pharmacol, Eur J Pharm Sci, Sci Rep, Drug Metab Dispos, J Ethnopharmacol, Drug Des Devel Ther, J Pharm Biomed Anal, Drug Metab Pharmacokinet, Biol Pharm Bull, Xenobiotica, Pharmazie, and ACS Pharmacol Transl Sci. Research fields span drug metabolism, pharmacokinetics, CYP450-mediated drug interactions, hepatotoxicity screening, and hepatic enzyme expression.

Automatically generated from the 14 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Adv Res; Gut microbiota and host Cyp450s co-contribute to pharmacokinetic variability in mice with non-alcoholic steatohepatitis: Effects vary from drug to drug; Authors - Jing Guo
human	IHC	Theranostics; Generation of hepatic spheroids using human hepatocyte-derived liver progenitor-like cells for hepatotoxicity screening.; Authors - Zhenyu Wang
rat	WB	J Ethnopharmacol; Integrated pharmacokinetic properties, tissue distribution and metabolism of multiple active constituents in DBD for the treatment of GEM-induced myelosuppression.; Authors - Xiaodan Qi
		Biochem Pharmacol; Effects of CYP3A4 variants and drug-drug interactions on the metabolism of fexinidazole.; Authors - Jinyu Hu
human	WB	Drug Des Devel Ther; Effects of Saikosaponin D on CYP1A2 and CYP2D6 in HepaRG Cells.; Authors - Hongfang Li
human	WB	Eur J Pharm Sci; PMID: 30776468; Authors - Vinay R Sonawane