Calsequestrin 2 Polyclonal antibody

Calsequestrin 2 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 27560-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IP, IHC, ELISA

Calsequestrin 2, CASQ2, PDIB2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman heart tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27560-1-AP targets Calsequestrin 2 in WB, IP, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26412

Product name: Recombinant human CASQ2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 273-399 aa of BC022288

Sequence: FAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Predict reactive species
Full Name calsequestrin 2 (cardiac muscle)
Calculated Molecular Weight 46 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC022288
Gene Symbol Calsequestrin 2
Gene ID (NCBI) 845
RRIDAB_2880908
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14958
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calsequestrin 2 (CASQ2) specifies the cardiac muscle family member of the calsequestrin family. Calsequestrin is localized to the sarcoplasmic reticulum in cardiac and slow skeletal muscle cells. CASQ2 is an important component of calcium handling as a calcium storage protein in the sarcoplasmic reticulum (SR), playing an important role in the regulation of the cardiac ryanodine receptor (RyR2)-mediated calcium release and SR calcium release refractoriness. Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

Protocols

Product Specific Protocols
WB protocol for Calsequestrin 2 antibody 27560-1-APDownload protocol
IHC protocol for Calsequestrin 2 antibody 27560-1-APDownload protocol
IP protocol for Calsequestrin 2 antibody 27560-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...