Tested Applications
| Positive WB detected in | HCT 116 cells, HeLa cells, human brain tissue, human kidney tissue, human placenta tissue, mouse testis tissue, rat testis tissue, HepG2 cells, Jurkat cells, MCF-7 cells, MDA-MB-231 cells, C2C12 cells, NIH/3T3 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human colon cancer tissue, human colon cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11380-1-AP targets DDB1 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1901 Product name: Recombinant human DDB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-401 aa of BC011686 Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHAS Predict reactive species |
| Full Name | damage-specific DNA binding protein 1, 127kDa |
| Calculated Molecular Weight | 1140 aa, 127 kDa |
| Observed Molecular Weight | 127 kDa |
| GenBank Accession Number | BC011686 |
| Gene Symbol | DDB1 |
| Gene ID (NCBI) | 1642 |
| RRID | AB_2088808 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16531 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDB1, also named as XAP1, XPCe, DDBa and XPE-BF, belongs to the DDB1 family. It is required for DNA repair. DDB1 binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. This antibody is specific to DDB1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DDB1 antibody 11380-1-AP | Download protocol |
| IP protocol for DDB1 antibody 11380-1-AP | Download protocol |
| WB protocol for DDB1 antibody 11380-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DDB1 Polyclonal antibody (Cat# 11380-1-AP) has 20 citations spanning journals including Nature Communications, Cell Death & Differentiation, Developmental Cell, Theranostics, Acta Pharm Sin B, Cell Reports, Frontiers in Immunology, FASEB Journal, and Virology. Research fields covered include stem cell biology, E3 ubiquitin ligase regulation, DNA damage signaling, cancer (ovarian, melanoma, lung, hepatocarcinoma), neuroinflammation, cerebellar development, T cell biology, and hepatitis C virus replication.
| Species | Application | Title |
|---|---|---|
Bone Res CUL4B orchestrates mesenchymal stem cell commitment by epigenetically repressing KLF4 and C/EBPδ | ||
Nat Commun Renal tubular GSDME protects cisplatin nephrotoxicity by impeding OGT-STAT3-S100A7A axis in male mice | ||
Theranostics Promotion of Cx26 mutants located in TM4 region for membrane translocation successfully rescued hearing loss | ||
Acta Pharm Sin B Molecular glue triggers degradation of PHGDH by enhancing the interaction between DDB1 and PHGDH | ||
Cell Death Differ Cullin 4B-RING E3 ligase negatively regulates the immunosuppressive capacity of mesenchymal stem cells by suppressing iNOS | ||
Cell Death Dis Cul4 E3 ubiquitin ligase regulates ovarian cancer drug resistance by targeting the antiapoptotic protein BIRC3.
|
Reviews
What customers say
Both reviews report successful Western Blot performance. One user achieved clear results at 1:2000 dilution in 5% milk with overnight incubation at 4°C on HEK293 cells, rating the antibody 4 out of 5. The other user, rating it 5 out of 5, used a 1:1000 dilution on U251 and Jurkat cell lysates with a standard 4-12% Bis-Tris gel and nitrocellulose transfer protocol, reporting reliable detection via ECL. Overall, the antibody is well-regarded for WB with straightforward protocols and strong signal.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Bernadette (Verified Customer) (09-24-2025) | The antibody worked well at 1:2000 dilution in 5% milk shaken overnight in 4 degree fridge on HEK293 cells.
|
Sarah (Verified Customer) (07-03-2019) | Total cell lysate (15 ug) was resolved on a 4-12% Bis-Tris gel and transferred to nitrocellulose membrane. Membrane was incubated in blocking buffer (5% milk/0.1% Tween-20) for 1h. Membrane was incubated with anti-DDB1 in blocking buffer (1:1000) at 4C overnight. After washing, membrane was incubated in anti-rabbit-HRP in blocking bufffer (1:3000) for 1h at room temperature. Protein was detected using ECL reagent and imaged on a chemiluminescence detection system.
 |
