• Featured Product
  • KD/KO Validated

CHOP/GADD153 Polyclonal antibody

CHOP/GADD153 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 15204-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA

CHOP; GADD153, CHOP, DDIT3, GADD153, CCAAT/enhancer-binding protein homologous protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTunicamycin treated HeLa cells, MCF-7 cells, HeLa cells, K-562 cells, RAW 264.7 cells
Positive IP detected inC6 cells
Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue, human thyroid cancer tissue, human cervical cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inTunicamycin treated HeLa cells
Positive FC (Intra) detected inTunicamycin treated HeLa cells

Samples need to be treated with ER stress.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15204-1-AP targets CHOP/GADD153 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, zebrafish, bovine, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7354

Product name: Recombinant human CHOP; GADD153 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-169 aa of BC003637

Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Predict reactive species
Full Name DNA-damage-inducible transcript 3
Calculated Molecular Weight 19 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC003637
Gene Symbol CHOP
Gene ID (NCBI) 1649
RRIDAB_2292610
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35638
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHOP, also known as GADD153 or DDIT3, is a highly conserved gene in both the structural and regulatory regions. Imposed by unfolded and misfolded proteins, CHOP is significantly induced by ER stress. CHOP is considered a proapoptotic marker of ER stress dependent cell death. CHOP acts as a dominant-negative inhibitor of the transcription factor C/EBP and LAP. It may play an important role in the malignant transformation of nevus to melanoma. The calculated molecular weight of CHOP is 19 kDa, but the protein migrates on an SDS-PAGE gel with an observed molecular mass of 29 kDa (PMID: 1547942).

Protocols

Product Specific Protocols
IF protocol for CHOP/GADD153 antibody 15204-1-APDownload protocol
IHC protocol for CHOP/GADD153 antibody 15204-1-APDownload protocol
IP protocol for CHOP/GADD153 antibody 15204-1-APDownload protocol
WB protocol for CHOP/GADD153 antibody 15204-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Immunol

Exosomes mediate the cell-to-cell transmission of IFN-α-induced antiviral activity.

Authors - Li Jianhua J
humanWB

Mol Cell

Mitochondrial DNA breaks activate an integrated stress response to reestablish homeostasis

Authors - Yi Fu
mouseIF

Acta Neuropathol

Wolframin is a novel regulator of tau pathology and neurodegeneration.

Authors - Shuo Chen
humanWB,IHC,IP,ChIP

Mol Cell

The FUS::DDIT3 fusion oncoprotein inhibits BAF complex targeting and activity in myxoid liposarcoma.

Authors - Hayley J Zullow
humanWB

Mol Cell

Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.

Authors - Bin Jiang
humanWB

Cell Rep Med

Development of an orally bioavailable CDK12/13 degrader and induction of synthetic lethality with AKT pathway inhibition

Authors - Yu Chang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Danyan (Verified Customer) (10-02-2025)

Performed as expected, with high sensitivity and low background across multiple applications.

  • Applications: Western Blot, Cell culture, Protein purification
  • Cell Tissue Type: HEK293T
FH

Morgane (Verified Customer) (09-15-2025)

Very specific, good signal, stress inductible

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HCT116
CHOP/GADD153 Antibody Western Blot validation (1/1000 dilution) in HCT116 (Cat no:15204-1-AP)
FH

Fan (Verified Customer) (03-22-2021)

Mouse retinal tissue was used. Single band detected at the right size.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
CHOP/GADD153 Antibody Western Blot validation (1:500 dilution) in (Cat no:15204-1-AP)
FH

Daniel (Verified Customer) (06-25-2019)

Specific staining detected in the proximal tubules.

  • Applications: Immunohistochemistry,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse kidney (TRACK model)
CHOP/GADD153 Antibody Immunohistochemistry, validation (1:100 dilution) in Mouse kidney (TRACK model) (Cat no:15204-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...