DDX46 Polyclonal antibody

• 

  WB analysis of HEK-293 using 16927-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 16927-1-AP (DDX46 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16927-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16927-1-AP (DDX46 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 16927-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 16927-1-AP (DDX46 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 16927-1-AP

  IP result of anti-DDX46 (IP:16927-1-AP, 4ug; Detection:16927-1-AP 1:1000) with HEK-293 cells lysate 1280 ug.

• 

  IHC staining of human stomach using 16927-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 16927-1-AP (DDX46 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 16927-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 16927-1-AP (DDX46 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DDX46 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 16927-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

DEAD box protein 46, EC:3.6.4.13, KIAA0801, Probable ATP-dependent RNA helicase DDX46

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, NIH/3T3 cells
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human stomach tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 2 publications below

Product Information

16927-1-AP targets DDX46 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10342

  Product name: Recombinant human DDX46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 682-1031 aa of BC012304

  Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
• Calculated Molecular Weight: 1031 aa, 117 kDa
• Observed Molecular Weight: 120-125 kDa
• GenBank Accession Number: BC012304
• Gene Symbol: DDX46
• Gene ID (NCBI): 9879
• RRID: AB_2090927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L014
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX46, also named as KIAA0801, is a 1031 amino acid protein, which belongs to the DEAD box helicase family. DDX46 has been shown to be required at the early step of pre-spliceosome assembly. It uses the energy released by the hydrolysis of ATP to rearrange local RNA-RNA or protein-RNA interactions. The nuclear DDX46 acted as a negative regulator of the antiviral innate response by recruiting the m6A'eraser' ALKBH5 to induce retention of antiviral innate mRNA in the nucleus.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Elife; Characterisation of the biflavonoid hinokiflavone as a pre-mRNA splicing modulator that inhibits SENP.; Authors - Andrea Pawellek
human	WB	PLoS Pathog; Epstein-Barr virus subverts mevalonate and fatty acid pathways to promote infected B-cell proliferation and survival.; Authors - Liang Wei Wang
human	IF	Sci Rep; Nuclear bodies formed by polyQ-ataxin-1 protein are liquid RNA/protein droplets with tunable dynamics.; Authors - Sunyuan Zhang
human	WB	Cell Rep; Epstein-Barr virus BNRF1 destabilizes SMC5/6 cohesin complexes to evade its restriction of replication compartments.; Authors - Stephanie Pei Tung Yiu
		Neoplasma; Oncogenic DDX46 promotes pancreatic cancer development and gemcitabine resistance by facilitating the JMJD6/CDK4 signaling pathway; Authors - Guang Yang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xiao (Verified Customer) (05-27-2025)

This antibody works very good for WB (HT1080, 293T cell lines), but not good for IP (HT1080, 293T cell lines) in my hand.

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:2000 for western blot