Use Able AI chat for product recommendations

DDX46 Polyclonal antibody

DDX46 Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

DEAD box protein 46, EC:3.6.4.13, KIAA0801, Probable ATP-dependent RNA helicase DDX46

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DDX46 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, NIH/3T3 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman stomach tissue, human ovary cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16927-1-AP targets DDX46 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10342

Product name: Recombinant human DDX46 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 682-1031 aa of BC012304

Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Calculated Molecular Weight 1031 aa, 117 kDa
Observed Molecular Weight 120-125 kDa
GenBank Accession NumberBC012304
Gene Symbol DDX46
Gene ID (NCBI) 9879
RRIDAB_2090927
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7L014
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX46, also named as KIAA0801, is a 1031 amino acid protein, which belongs to the DEAD box helicase family. DDX46 has been shown to be required at the early step of pre-spliceosome assembly. It uses the energy released by the hydrolysis of ATP to rearrange local RNA-RNA or protein-RNA interactions. The nuclear DDX46 acted as a negative regulator of the antiviral innate response by recruiting the m6A'eraser' ALKBH5 to induce retention of antiviral innate mRNA in the nucleus.

Protocols

Product Specific Protocols
IHC protocol for DDX46 antibody 16927-1-APDownload protocol
IP protocol for DDX46 antibody 16927-1-APDownload protocol
WB protocol for DDX46 antibody 16927-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

DDX46 Polyclonal antibody (Cat# 16927-1-AP) has 7 citations published in Cell Reports, Scientific Reports, PLoS Pathogens, Molecular Biology of the Cell, Neoplasma, eLife, and bioRxiv. Research fields span virology (EBV replication), neurodegeneration (polyQ-ataxin-1), phase separation (YAP condensates), oncology (pancreatic cancer), RNA splicing, and epigenetics (Xist-mediated gene silencing).

SpeciesApplicationTitle
humanWB

Cell Rep

Epstein-Barr virus BNRF1 destabilizes SMC5/6 cohesin complexes to evade its restriction of replication compartments.

Authors - Stephanie Pei Tung Yiu
humanWB

PLoS Pathog

Epstein-Barr virus subverts mevalonate and fatty acid pathways to promote infected B-cell proliferation and survival.

Authors - Liang Wei Wang
humanIF

Sci Rep

Nuclear bodies formed by polyQ-ataxin-1 protein are liquid RNA/protein droplets with tunable dynamics.

Authors - Sunyuan Zhang
humanIF

Mol Biol Cell

Investigating the functional components of YAP condensates.

Authors - Janelle S. Bellot

Neoplasma

Oncogenic DDX46 promotes pancreatic cancer development and gemcitabine resistance by facilitating the JMJD6/CDK4 signaling pathway

Authors - Guang Yang
humanIF

Elife

Characterisation of the biflavonoid hinokiflavone as a pre-mRNA splicing modulator that inhibits SENP.

Authors - Andrea Pawellek

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 16927-1-AP (Lot 00022049) is rated 3 out of 5. The reviewer, Xiao Lei, tested the antibody on May 27, 2025, using HT1080 and 293T cell lines. They reported that it performed very well for Western Blot at a 1:2000 dilution, but did not work well for Immunoprecipitation under the same conditions. Overall, the feedback suggests the antibody is reliable for WB but may require optimization or may not be ideal for IP applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xiao (Verified Customer) (05-27-2025)

This antibody works very good for WB (HT1080, 293T cell lines), but not good for IP (HT1080, 293T cell lines) in my hand.

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:2000 for western blot
Loading...
||
New chat

Able™

正在加载,请稍候...