Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

DKK1 Polyclonal antibody

DKK1 Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Dickkopf 1, Dickkopf1, Dickkopf-1, Dickkopf-related protein 1, DKK 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for DKK1 in ?

Tested Applications

Positive WB detected inA549 cells, mouse brain tissue, K-562 cells, HeLa cells, mouse heart tissue, rat brain tissue, rat heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21112-1-AP targets DKK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15110

Product name: Recombinant human DKK1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 32-191 aa of BC001539

Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLR

Predict reactive species
Full Name dickkopf homolog 1 (Xenopus laevis)
Calculated Molecular Weight 266 aa, 29 kDa
Observed Molecular Weight 30-35 kDa
GenBank Accession NumberBC001539
Gene Symbol DKK1
Gene ID (NCBI) 22943
RRIDAB_10733097
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO94907
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment.

Protocols

Product Specific Protocols
WB protocol for DKK1 antibody 21112-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The DKK1 polyclonal antibody (Cat# 21112-1-AP) has 78 citations published in journals including Nature Communications, Cell Metabolism, Theranostics, Cell Death & Disease, FASEB Journal, and Journal of Experimental & Clinical Cancer Research. Research fields encompass bone biology and osteoporosis, multiple cancer types (breast, lung, gastric, colorectal, renal, prostate), Wnt/β-catenin signaling, ferroptosis, fibrosis, neuroprotection, cardiovascular disease, and immune regulation.

SpeciesApplicationTitle
mouseWB

Cell Metab

Gut microbial alterations in arginine metabolism determine bone mechanical adaptation

Authors - Dan Wang
mouse,humanWB

Nat Commun

Cancer stem cell regulated phenotypic plasticity protects metastasized cancer cells from ferroptosis.

Authors - Mingming Wu
  • KD Validated
humanIHC,IF

Nat Commun

Stroma-derived Dickkopf-1 contributes to the suppression of NK cell cytotoxicity in breast cancer

Authors - Seunghyun Lee
mouseWB

Nat Commun

Rescuing SERCA2 pump deficiency improves bone mechano-responsiveness in type 2 diabetes by shaping osteocyte calcium dynamics

Authors - Xi Shao
humanWB,IHC

Theranostics

BPI-9016M, a c-Met inhibitor, suppresses tumor cell growth, migration and invasion of lung adenocarcinoma via miR203-DKK1.

Authors - Panpan Zhang
  • KD Validated
humanWB

J Exp Clin Cancer Res

Depleting PTOV1 sensitizes non-small cell lung cancer cells to chemotherapy through attenuating cancer stem cell traits.

Authors - Zhiqiang Wu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 21112-1-AP is highly positive. The reviewer, Sai Sindhura Balusa, rated the antibody 5 out of 5 stars and described it as a "very good antibody." The review was posted on January 8, 2026, using lot 00101755 at a dilution of 1:1000 for Western Blot and Immunoprecipitation applications. Overall, the feedback is favorable, indicating strong performance for these applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Sai Sindhura (Verified Customer) (01-08-2026)

Very good antibody

  • Applications: Western Blot, Immunoprecipitation
  • Primary Antibody Dilution: 1:1000
Loading...
||
New chat

Able™

正在加载,请稍候...