DLX4 Polyclonal antibody

DLX4 Polyclonal Antibody for ELISA
Cat No. 12084-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Beta protein 1, BP1, distal less homeobox 4, DLX4, DLX7, DLX8, DLX9, Homeobox protein DLX 4, Homeobox protein DLX 7, Homeobox protein DLX 8

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

12084-1-AP targets DLX4 in ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2716

Product name: Recombinant human DLX4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-240 aa of BC016145

Sequence: MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRPYGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM

Predict reactive species
Full Name distal-less homeobox 4
Calculated Molecular Weight 240 aa, 26 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC016145
Gene Symbol DLX4
Gene ID (NCBI) 1748
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92988
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Globin genes' expression in the β-globin cluster is restricted to erythroid cells, with five different genes expressed during embryonic (e), fetal (Gγ and Aγ), and adult (δ and β) development [PMID:9461381]. Transcriptional activation of globin genes occurs not only by the binding of transcriptional activator proteins to the promoter of the gene being activated but also by a regulatory element located 6 to 18 kb upstream of the β-globin cluster, the locus control region (LCR)[PMID:8791532]. DXL4, also known as BP1, binds to two silencer DNA sequences upstream of the adult human β-globin gene and to a negative control region upstream of the adult δ-globin gene [PMID:11909945].

Loading...
||
New chat Able
正在加载,请稍候...