Desmocollin 2 Polyclonal antibody

Desmocollin 2 Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 13876-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

DSC2, Desmocollin-3, Desmocollin-2, Desmocollin 3, CDHF2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HeLa cells, HepG2 cells
Positive IHC detected inhuman oesophagus tissue, human skin cancer tissue, mouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13876-1-AP targets Desmocollin 2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4956

Product name: Recombinant human DSC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-357 aa of BC063291

Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR

Predict reactive species
Full Name desmocollin 2
Calculated Molecular Weight 100 kDa
Observed Molecular Weight 110-120 kDa
GenBank Accession NumberBC063291
Gene Symbol Desmocollin 2
Gene ID (NCBI) 1824
RRIDAB_2877983
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02487
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelial and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in the DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.

Protocols

Product Specific Protocols
WB protocol for Desmocollin 2 antibody 13876-1-APDownload protocol
IHC protocol for Desmocollin 2 antibody 13876-1-APDownload protocol
IF protocol for Desmocollin 2 antibody 13876-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Dev Cell

Essential Functions of Glycans in Human Epithelia Dissected by a CRISPR-Cas9-Engineered Human Organotypic Skin Model.

Authors - Sally Dabelsteen
mouseWB

Sci Total Environ

Environmental cadmium impairs blood-testis barrier via activating HRI-responsive mitochondrial stress in mice.

Authors - Guo-Xiang Zhou
humanIF

Br J Cancer

Mapping of truncated O-glycans in cancers of epithelial and non-epithelial origin.

Authors - Troels Boldt Rømer
humanWB

Bioconjug Chem

Transforms of Cell Surface Glycoproteins Charge Influences Tumor Cell Metastasis via Atypically Inhibiting Epithelial-Mesenchymal Transition Including Matrix Metalloproteinases and Cell Junctions

Authors - Mingzhe Wang
humanIHC

Mol Ther Oncolytics

Exosomal miR-205-5p enhances angiogenesis and nasopharyngeal carcinoma metastasis by targeting desmocollin-2.

Authors - Wenjuan Yang
humanWB,IHC,IF

BMC Cancer

Desmoglein 2 and desmocollin 2 depletions promote malignancy through distinct mechanisms in triple-negative and luminal breast cancer

Authors - Ji-Yuan Han
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Chi (Verified Customer) (08-18-2025)

The antibody was used to detect Desmocollin in human iPSC-derived cardiomyocytes by IF. It worked just fine, but it gave us significant background noise.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: human iPSC-derived cardiomyocytes
Desmocollin 2 Antibody Immunofluorescence validation (1:200 dilution) in human iPSC-derived cardiomyocytes (Cat no:13876-1-AP)
FH

Kiara (Verified Customer) (07-28-2025)

This primary antibody did not pass internal validation for IF and it did indeed not give us a reliable signal for IF of methanol fixed iPSC-cardiomyocytes.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:400
  • Cell Tissue Type: iPSC-derived cardiomyocytes
Desmocollin 2 Antibody Immunofluorescence validation (1:400 dilution) in iPSC-derived cardiomyocytes (Cat no:13876-1-AP)
FH

Jane (Verified Customer) (02-03-2022)

One specific band was found around 120kDa, however, the signal is weak so need to use lower dilution

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Heart tissue
Loading...
||
New chat Able
正在加载,请稍候...