Featured Product
KD/KO Validated

EEF1B2 Polyclonal antibody

EEF1B2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10483-1-AP

Publications (14)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

EEF1B, EEF1B1, EEF1B2, EF 1 beta, EF1B, Elongation factor 1 beta

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC

WB analysis of PC-3 using 10483-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 10483-1-AP
WB result of EEF1B2 antibody (10483-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EEF1B2 transfected HeLa cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 10483-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse kidney using 10483-1-AP
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10483-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 10483-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 10483-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 10483-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 10483-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10483-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 10483-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of SKOV-3 using 10483-1-AP
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10483-1-AP (EEF1B2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 10483-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10483-1-AP (EEF1B2 antibody) at dilution of 1:100 (under 25x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EEF1B2 in ?

Overview

Tested Applications
Product Information
Publications (14)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	PC-3 cells, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, SKOV-3 cells, mouse kidney tissue
Positive IHC detected in	human pancreas cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10483-1-AP targets EEF1B2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0742 Product name: Recombinant human EEF1B2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC004931 Sequence: MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI Predict reactive species
Full Name	eukaryotic translation elongation factor 1 beta 2
Calculated Molecular Weight	29 kDa
Observed Molecular Weight	34 kDa
GenBank Accession Number	BC004931
Gene Symbol	EEF1B2
Gene ID (NCBI)	1933
RRID	AB_2096985
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P24534
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In eukaryotes, the translation elongation factor eEF1A responsible for transporting amino-acylated tRNA to the ribosome forms a higher-order complex, eEF1H, with its guanine-nucleotide-exchange factor eEF1B. eEF1B consists of three subunits: eEF1B alpha, eEF1B beta and eEF1B gamma. The eEF1B2 possess the nucleotide-exchange activity. Although several models on the basis of in vitro experiments have been proposed for the macromolecular organization of the eEF1H complex, these models differ in various aspects. The human eukaryote elongation factor 1 beta 2 (eEF1B2) migrated as a 30 kDa protein in SDS-PAGE. This antibody is a rabbit polyclonal antibody raised against full length EEF1B2 of human origin.

Protocols

Product Specific Protocols
IHC protocol for EEF1B2 antibody 10483-1-AP	Download protocol
WB protocol for EEF1B2 antibody 10483-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The EEF1B2 Polyclonal antibody (Cat# 10483-1-AP) has 14 citations across journals including PNAS, Cell Proliferation, Cell Mol Life Sci, J Cell Mol Med, Front Mol Biosci, Proteomics, PLoS Genetics, Brain Sciences, Amino Acids, Life Science Alliance, PLoS One, Molecular Cell Biology, Biotechniques, and bioRxiv. Research fields span protein translation, ferroptosis, stem cell biology, cancer biomarkers, neurology, and reproductive biology, with applications mainly in WB, IF, and IP.

Species	Application	Title
human	WB	Proc Natl Acad Sci U S A Autism- and epilepsy-associated EEF1A2 mutations lead to translational dysfunction and altered actin bundling Authors - Muhaned S Mohamed View Article
rat	IF	Cell Prolif Rack1-mediated ferroptosis affects hindgut development in rats with anorectal malformations: Spatial transcriptome insights Authors - Chen-Yi Wang View Article
mouse	WB	Cell Mol Life Sci EEF1B2 regulates bone marrow-derived mesenchymal stem cells bone-fat balance via Wnt/β-catenin signaling Authors - Shuhao Feng KD Validated View Article
mouse	WB	J Cell Mol Med Deficiency of TPPP2, a factor linked to oligoasthenozoospermia, causes subfertility in male mice. Authors - Feng Zhu View Article
mouse	WB	Front Mol Biosci Heat Shock-Induced Dephosphorylation of Eukaryotic Elongation Factor 1BδL by Protein Phosphatase 1. Authors - Taku Kaitsuka View Article
rat	WB	Proteomics Prenatal alcohol exposure alters phosphorylation and glycosylation of proteins in rat offspring liver. Authors - Fofana Bourlaye B View Article

Reviews

5.0 out of 5

Add a review

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating. The customer used it for Western Blot on mouse heart tissue and confirmed it is knockout (KO) validated in KO mice. Overall, the feedback is positive, highlighting the antibody's strong performance and its verified specificity through knockout validation.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

WEI (Verified Customer) (01-17-2020)

KO validated by KO mice