EFTUD2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EFTUD2 Polyclonal antibody (10208-1-AP)

• Featured Product
• KD/KO Validated

EFTUD2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 10208-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, PLA

Synonyms

Snu114, SNRP116, KIAA0031, hSNU114, Elongation factor Tu GTP-binding domain-containing protein 2

• 

  WB analysis of HeLa using 10208-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10208-1-AP (EFTUD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10208-1-AP

  WB result of EFTUD2 antibody (10208-1-AP; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EFTUD2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10208-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10208-1-AP (EFTUD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10208-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10208-1-AP (EFTUD2 Antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10208-1-AP

  IP result of anti-EFTUD2 (IP:10208-1-AP, 3ug; Detection:10208-1-AP 1:1000) with HeLa cells lysate 4650ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment using 10208-1-AP

  IP result of EFTUD2 (10208-1-AP for IP and Detection) with HeLa cell lysate.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10208-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EFTUD2 antibody (10208-1-AP) at dilution of 1:800 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-phalloidin (green).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EFTUD2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10208-1-AP targets EFTUD2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA, PLA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0279

  Product name: Recombinant human EFTUD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 13-217 aa of BC002360

  Sequence: IGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTA

• Full Name: elongation factor Tu GTP binding domain containing 2
• Calculated Molecular Weight: 116 kDa
• Observed Molecular Weight: 116 kDa
• GenBank Accession Number: BC002360
• Gene Symbol: EFTUD2
• Gene ID (NCBI): 9343
• RRID: AB_2095834
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15029
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EFTUD2 encodes the 116 kDa U5 small nuclear ribonecleoprotein (snRNP) component, also named SNU114, it has GTP binding activity and is required for pre-mRNA splicing. Evolutionarily conserved human snRNP protein (U5-116kDa) is homologous to the ribosomal elongation factor EF-2 (ribosomal translocase). Defects in EFTUD2 are the cause of mandibulofacial dysostosis with microcephaly (MFDM). So far, acetylation and phosphorylation sites of EFTUD2 have been identified. Catolog#10208-1-AP is a rabbit polyclonal antibody raised against the N-terminal of human EFTUD2.

Publications

What published studies show

The EFTUD2 Polyclonal antibody (cat. no. 10208-1-AP) has 22 citations. They appear in journals including Nature Immunology, Neuron, Nucleic Acids Research, Journal of Experimental & Clinical Cancer Research, Science Advances, Cell Reports, iScience, FASEB Journal, RNA, Journal of Biological Chemistry, Proteomics, Journal of Molecular Biology, Journal of Neurochemistry, Poultry Science, Heliyon, and Cancer Research and Treatment. Research fields span spliceosome/RNA splicing, ferroptosis and neurodegeneration, cancer biology, proteomics, and muscle differentiation.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Immunol; Syndromic immune disorder caused by a viable hypomorphic allele of spliceosome component Snrnp40.; Authors - Duanwu Zhang
human	WB	Neuron; Spliceosomal GTPase Eftud2 deficiency-triggered ferroptosis leads to Purkinje cell degeneration; Authors - Guochao Yang
human	WB	Nucleic Acids Res; XAB2 depletion induces intron retention in POLR2A to impair global transcription and promote cellular senescence.; Authors - Shuai Hou
		Nucleic Acids Res; Neurochondrin promotes U5 snRNP maturation by regulating AAR2 release from PRPF8.; Authors - Tingrong Ren
human	IHC,IF,CoIP	J Exp Clin Cancer Res; The feedback loop of EFTUD2/c-MYC impedes chemotherapeutic efficacy by enhancing EFTUD2 transcription and stabilizing c-MYC protein in colorectal cancer; Authors - Xiaojian Zhu
human	WB	Sci Adv; Immunopeptidomics-guided discovery and characterization of neoantigens for personalized cancer immunotherapy.; Authors - Yangyang Cai