Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EGFR Monoclonal antibody

EGFR Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66455-1-Ig
Clone No.2A2H10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF, CoIP, ELISA

2A2H10, EGF R, EGF Receptor , Epidermal growth factor receptor, Proto-oncogene c-ErbB-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, EC109 cells, A549 cells, HeLa cells, HepG2 cells, LNCaP cells, PC-3 cells, SKOV-3 cells, MDA-MB-468 cells, MDA-MB-231 cells, PC-3 clles
Positive IHC detected inhuman tonsillitis tissue, human breast cancer tissue, human cervical cancer tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human placenta tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66455-1-Ig targets EGFR in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24947

Product name: Recombinant human EGFR protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 291-534 aa of BC094761

Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC

Predict reactive species
Full Name epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian)
Calculated Molecular Weight 1210 aa, 134 kDa
Observed Molecular Weight 145-180 kDa
GenBank Accession NumberBC094761
Gene Symbol EGFR
Gene ID (NCBI) 1956
RRIDAB_2881824
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP00533
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGFR, also named as ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer.

Protocols

Product Specific Protocols
IHC protocol for EGFR antibody 66455-1-IgDownload protocol
WB protocol for EGFR antibody 66455-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Signal Transduct Target Ther

Dual-targeting pharmacological UFMylation inhibition reprograms tumor and immune microenvironments to achieve long-term glioblastoma regression.

Authors - Pengcheng Tan
humanWB

Cancer Res

Adaptive Regulation of dNTP Homeostasis Confers Osimertinib Resistance in EGFR-Mutant Non-small Cell Lung Carcinoma.

Authors - Qian Xie
humanWB

Cancer Res

Inhibition of EGFR Overcomes Acquired Lenvatinib Resistance Driven by STAT3-ABCB1 Signaling in Hepatocellular Carcinoma

Authors - Beiyuan Hu
human

Nat Commun

EGFR core fucosylation, induced by hepatitis C virus, promotes TRIM40-mediated-RIG-I ubiquitination and suppresses interferon-I antiviral defenses

Authors - Qiu Pan
humanWB

Nat Commun

Therapeutic potential of the secreted Kazal-type serine protease inhibitor SPINK4 in colitis

Authors - Ying Wang
humanWB

Nat Commun

Self-reporting photodynamic nanobody conjugate for precise and sustainable large-volume tumor treatment

Authors - Yingchao Chen

Reviews

    4.0 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


k. (Verified Customer) (10-26-2023)

This antibody worked well for human cells and mouse liver cell proteins at 1:500 or 1:1000 concentrations at 4 °C over a night of incubation.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human Liver cells

Christos (Verified Customer) (02-13-2023)

-35ug protein extract were loaded per well -Transfer was performed for 2hr at 400mA at 4oC, on a Nitrocellulose Blotting Membrane -Membrane blocking was performed in 5% non-fat milk in PBS-Tween20 at room temperature, under mild shacking -Antibodies dilutions were performed in 5% non-fat milk in PBS-Tween20. -Incubations with the primary antibodies were performed as followed: 1)EGFR: 1:1000 for 1.5hr at 4oC 2)tubulin (sc32293, Santa Cruz): 1:5000 for 1.5hr at 4oC -Incubations with the secondary antibodies were performed with Rb pAb to Ms IgG (HRP) (ab 6728, Abcam) at a 1:20000 dilution, for 1hr at 4oC.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: Human breast cancer cells/ SKBR3, MDA-MB-231
EGFR Antibody Western Blot validation (1/1000 dilution) in Human breast cancer cells/ SKBR3, MDA-MB-231 (Cat no:66455-1-Ig)

Guorong (Verified Customer) (03-31-2022)

A band of approximately 160 kDa was detected

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ARPE-19
EGFR Antibody Western Blot validation (1:1000 dilution) in ARPE-19 (Cat no:66455-1-Ig)

Carly (Verified Customer) (11-17-2020)

Tested using EDTA plasma on an antibody microarray

  • Applications: Other
Loading...
||
New chat

Able

正在加载,请稍候...