Tested Applications
| Positive WB detected in | A431 cells, EC109 cells, A549 cells, HeLa cells, HepG2 cells, LNCaP cells, PC-3 cells, SKOV-3 cells, MDA-MB-468 cells, MDA-MB-231 cells, PC-3 clles |
| Positive IHC detected in | human tonsillitis tissue, human breast cancer tissue, human cervical cancer tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human placenta tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66455-1-Ig targets EGFR in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24947 Product name: Recombinant human EGFR protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 291-534 aa of BC094761 Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC Predict reactive species |
| Full Name | epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) |
| Calculated Molecular Weight | 1210 aa, 134 kDa |
| Observed Molecular Weight | 145-180 kDa |
| GenBank Accession Number | BC094761 |
| Gene Symbol | EGFR |
| Gene ID (NCBI) | 1956 |
| RRID | AB_2881824 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P00533 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EGFR, also named as ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EGFR antibody 66455-1-Ig | Download protocol |
| WB protocol for EGFR antibody 66455-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Nat Commun EGFR core fucosylation, induced by hepatitis C virus, promotes TRIM40-mediated-RIG-I ubiquitination and suppresses interferon-I antiviral defenses | ||
Mol Cell N7-Methylguanosine tRNA modification enhances oncogenic mRNA translation and promotes intrahepatic cholangiocarcinoma progression.
| ||
Cancer Res Inhibition of EGFR Overcomes Acquired Lenvatinib Resistance Driven by STAT3-ABCB1 Signaling in Hepatocellular Carcinoma | ||
Pharmacol Res Upregulation of CSNK1A1 induced by ITGB5 confers to hepatocellular carcinoma resistance to sorafenib in vivo by disrupting the EPS15/EGFR complex | ||
Cell Death Dis Neurokinin-1 receptor promotes non-small cell lung cancer progression through transactivation of EGFR. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
k. (Verified Customer) (10-26-2023) | This antibody worked well for human cells and mouse liver cell proteins at 1:500 or 1:1000 concentrations at 4 °C over a night of incubation.
|
Christos (Verified Customer) (02-13-2023) | -35ug protein extract were loaded per well -Transfer was performed for 2hr at 400mA at 4oC, on a Nitrocellulose Blotting Membrane -Membrane blocking was performed in 5% non-fat milk in PBS-Tween20 at room temperature, under mild shacking -Antibodies dilutions were performed in 5% non-fat milk in PBS-Tween20. -Incubations with the primary antibodies were performed as followed: 1)EGFR: 1:1000 for 1.5hr at 4oC 2)tubulin (sc32293, Santa Cruz): 1:5000 for 1.5hr at 4oC -Incubations with the secondary antibodies were performed with Rb pAb to Ms IgG (HRP) (ab 6728, Abcam) at a 1:20000 dilution, for 1hr at 4oC.
|
Guorong (Verified Customer) (03-31-2022) | A band of approximately 160 kDa was detected
|
Carly (Verified Customer) (11-17-2020) | Tested using EDTA plasma on an antibody microarray
|























































