EIF3J Polyclonal antibody

• Home
• Products
• Primary Antibodies
• EIF3J Polyclonal antibody (10439-1-AP)

• Featured Product
• KD/KO Validated

EIF3J Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10439-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Eukaryotic translation initiation factor 3 subunit 1, EIF3S1, eIF-3-alpha, eIF3 p35, eIF3 alpha

• 

  WB analysis of HeLa using 10439-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10439-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10439-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 10439-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10439-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 10439-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 10439-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10439-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10439-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 10439-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 10439-1-AP (EIF3J antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10439-1-AP

  IP result of anti-EIF3J (IP:10439-1-AP, 4ug; Detection:10439-1-AP 1:500) with HeLa cells lysate 880ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10439-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10439-1-AP (EIF3J antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10439-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10439-1-AP (EIF3J antibody) at dilution of 1:10 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10439-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using EIF3J antibody (10439-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EIF3J in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, Jurkat cells, K-562 cells, MCF-7 cells, SKOV-3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10439-1-AP targets EIF3J in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0678

  Product name: Recombinant human EIF3J protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-258 aa of BC002719

  Sequence: MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM

• Full Name: eukaryotic translation initiation factor 3, subunit J
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC002719
• Gene Symbol: EIF3J
• Gene ID (NCBI): 8669
• RRID: AB_2097082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75822
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EIF3 has a key role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex(PMID:17588516). The eIF3 complex stimulates several steps in the translation initiation pathway, including dissociation of 80S ribosomes into 40S and 60S subunits, binding of a ternary complex (TC) consisting of Met-tRNA , eIF2, and GTP to the small subunit (forming the 43S preinitiation complex) and recruitment of mRNA to the 43 S complex to produce the 48S complex (PMID:11560931) EIF3J was identified as a high copy suppressor of the temperature-sensitive (Ts-) phenotype of the rpg1-1 allele of TIF32/RPG1, encoding the largest subunit of yeast eIF3 (eIF3a) (PMID:10488093).

Publications

What published studies show

EIF3J Polyclonal antibody (Cat# 10439-1-AP) has 4 citations published in Cell Death & Disease, Journal of Cell Biology, Journal of Virology, and bioRxiv. The research fields covered include stress granule assembly, mTOR-mediated nutrient sensing, autophagy regulation, viral IRES-driven translation, and innate immune modulation in human and pig models.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Death Dis; Nitric oxide triggers the assembly of "type II" stress granules linked to decreased cell viability.; Authors - Anaïs Aulas
human	WB,IF,IP	J Cell Biol; eIF4GI links nutrient sensing by mTOR to cell proliferation and inhibition of autophagy.; Authors - Ramírez-Valle Francisco F ; KD Validated
pig	WB	J Virol; VP3 protein of Senecavirus A promotes viral IRES-driven translation and attenuates innate immunity by specifically relocalizing hnRNPA2B1; Authors - Lu Li
human	WB	bioRxiv; PARP10 is Critical for Stress Granule Initiation; Authors - Aravinth Kumar Jayabalan