Tested Applications
| Positive WB detected in | mouse brain tissue, A2780 cells, mouse testis tissue | 
| Positive IP detected in | mouse brain tissue | 
| Positive IHC detected in | human prostate cancer tissue, human colon cancer tissue,  human stomach cancer tissue,  mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below | 
| WB | See 12 publications below | 
| IHC | See 2 publications below | 
| IF | See 1 publications below | 
| IP | See 1 publications below | 
| RIP | See 1 publications below | 
Product Information
17069-1-AP targets EIF5A1/EIF5A2 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag10895 Product name: Recombinant human EIF5A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-153 aa of BC036072 Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Predict reactive species | 
                                    
| Full Name | eukaryotic translation initiation factor 5A2 | 
| Calculated Molecular Weight | 153 aa, 17 kDa | 
| Observed Molecular Weight | 17 kDa | 
| GenBank Accession Number | BC036072 | 
| Gene Symbol | EIF5A2 | 
| Gene ID (NCBI) | 56648 | 
| RRID | AB_2262009 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9GZV4 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Eukaryotic initiation factor 5A (EIF5A) plays an essential role in the viability of eukaryotic cells. EIF5A is known to act as a translation initiation factor specific for a small number of mRNAs, a cellular target of HIV-1 REV protein, and an exportin-4-dependent nuclear export cargo. It is also involved in mRNA turnover and the establishment of actin polarity. [PMID:16157662]. EIF5A2, one isoform of EIF5A, has a key at the level of mRNA turnoverby acting downstream of decapping. It also involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity [PMID:14622290]. EIF5A2 shares 84% identity of amino acid sequence with EIF5A1 isoform, so EIF5A2 poly-antibody could recognize both EIF5A2 and EIF5A1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for EIF5A1/EIF5A2 antibody 17069-1-AP | Download protocol | 
| IP protocol for EIF5A1/EIF5A2 antibody 17069-1-AP | Download protocol | 
| WB protocol for EIF5A1/EIF5A2 antibody 17069-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Oncogene Identification of genes that promote PI3K pathway activation and prostate tumour formation | ||
PLoS Biol Klf5 down-regulation induces vascular senescence through eIF5a depletion and mitochondrial fission. | ||
FASEB J Global analyses of mRNA expression in human sensory neurons reveal eIF5A as a conserved target for inflammatory pain. | ||
PLoS One Novel functional MAR elements of double minute chromosomes in human ovarian cells capable of enhancing gene expression. | ||
Gene Exploring extrahepatic metastasis of hepatocellular carcinoma based on methylation driver genes and establishing a prognostic model for hepatocellular carcinoma | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sarah-Eve (Verified Customer) (02-19-2023)  | Very Nice and specific signal, works well 
  | 





















