• Featured Product
  • KD/KO Validated

EIF6 Polyclonal antibody

EIF6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 10291-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

integrin beta 4 binding protein, eIF 6, CAB, B4 integrin interactor, B(2)GCN homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, HeLa cells, mouse liver tissue, COLO 320 cells, HepG2 cells
Positive IHC detected inhuman prostate cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10291-1-AP targets EIF6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0324

Product name: Recombinant human EIF6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-245 aa of BC001119

Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT

Predict reactive species
Full Name eukaryotic translation initiation factor 6
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC001119
Gene Symbol EIF6
Gene ID (NCBI) 3692
RRIDAB_2096515
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP56537
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

p27(BBP/eIF6) is an evolutionarily conserved protein that was originally identified as p27(BBP), It functions as an interactor of the cytoplasmic domain of integrin 4 and as the putative translation initiation factor eIF6. p27BBP is found in two pools: one nuclear pool enriched in the perinucleolar region, and one cytoplasmic pool. p27BBP binds to the fibronectin type III domains of integrin 4 subunit (ITGB4), an important functional component of hemidesmosomes, and help link ITGB4 to the intermediate filament cytoskeleton. In vitro and in vivo studies demonstrated that p27BBP is essential for cell viability and has a primary function in the biogenesis of the 60S ribosomal subunit. p27BBP protein is increased in rapidly cycling cells and decreased in villous cells committed to apoptotic cell death. In dysplastic colorectal adenomas and carcinomas, p27BBP displayed a large increase of its nucleolar component and was associated with the nuclear matrix. In particular, p27BBP increased progressively from adenomas to carcinomas and was related to the tumor stage.

Protocols

Product Specific Protocols
IF protocol for EIF6 antibody 10291-1-APDownload protocol
IHC protocol for EIF6 antibody 10291-1-APDownload protocol
WB protocol for EIF6 antibody 10291-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nature

MicroRNA silencing through RISC recruitment of eIF6.

Authors - Chendrimada Thimmaiah P TP
  • KD Validated
humanWB

Cell Stem Cell

HectD1 controls hematopoietic stem cell regeneration by coordinating ribosome assembly and protein synthesis.

Authors - Kaosheng Lv
humanWB,IF

Exp Gerontol

Mechanistic insights into EIF6 as a target of Apigenin in alleviating chondrocyte senescence

Authors - Erliang Li
humanWB

Biochem Biophys Res Commun

Mitochondrial function is impaired in yeast and human cellular models of Shwachman Diamond syndrome.

Authors - Henson Adrianna L AL
humanWB

Pediatr Blood Cancer

Impaired growth, hematopoietic colony formation, and ribosome maturation in human cells depleted of Shwachman-Diamond syndrome protein SBDS.

Authors - Sezgin Gulay G
humanWB

Evid Based Complement Alternat Med

Protective Effects of Scutellarin on Human Cardiac Microvascular Endothelial Cells against Hypoxia-Reoxygenation Injury and Its Possible Target-Related Proteins.

Authors - Meina Shi
Loading...
||
New chat

Able

正在加载,请稍候...