ELA2 Polyclonal antibody

• 

ELA2 Polyclonal Antibody for ELISA

Cat No. 17943-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

IF, ELISA

Synonyms

Bone marrow serine protease, ELA2, ELANE, Elastase 2, elastase 2, neutrophil, GE, HLE, HNE, Human leukocyte elastase, Medullasin, NE, Neutrophil elastase, PMN E, PMN elastase

---

Published Applications

• IF: See 1 publications below

Product Information

17943-1-AP targets ELA2 in IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12372

  Product name: Recombinant human ELA2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-203 aa of BC074816

  Sequence: ALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSG

• Full Name: elastase 2, neutrophil
• Calculated Molecular Weight: 267 aa, 29 kDa
• GenBank Accession Number: BC074816
• Gene Symbol: ELA2
• Gene ID (NCBI): 1991
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P08246
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
bovine	IF	Biol Trace Elem Res; Effect of Copper, Zinc, and Selenium on the Formation of Bovine Neutrophil Extracellular Traps.; Authors - Xiechen Zhou
		Cell Death Discov; Neutrophil extracellular traps induced by VP1 contribute to pulmonary edema during EV71 infection.; Authors - Nan Wang