Use Able AI chat for product recommendations

Neutrophil Elastase Polyclonal antibody

Neutrophil Elastase Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27642-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, ELISA

ELA2, ELANE, EC:3.4.21.37, Elastase 2, HLE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, U-937 cells
Positive IHC detected inhuman lymphoma tissue, mouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27642-1-AP targets Neutrophil Elastase in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26634

Product name: Recombinant human ELA2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 206-267 aa of BC074816

Sequence: LVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH

Predict reactive species
Full Name elastase 2, neutrophil
Calculated Molecular Weight 267 aa, 29 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC074816
Gene Symbol ELA2
Gene ID (NCBI) 1991
RRIDAB_2918126
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08246
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ELA2(Neutrophil elastase) is also named as ELAL, NE, HLE, HNE, PMN-E, SERP1, GE, ELANE and belongs to the peptidase S1 family. It is a 33-kDa enzyme with several isoforms that differ in their extent of glycosylation(PMID:12223222). Human neutrophil elastase (HNE) is a serine protease with potent proteolytic activity (3), which is reported to cause mucin secretion (degranulation)(PMID:12169572). It may contribute to the directed migration of leukocytes into flamed postcapillary venules in addition to contributing to the process of tissue emigration(PMID:9683424). The full length protein has a signal peptide,propeptide and three glycosylation sites.

Protocols

Product Specific Protocols
IF protocol for Neutrophil Elastase antibody 27642-1-APDownload protocol
IHC protocol for Neutrophil Elastase antibody 27642-1-APDownload protocol
WB protocol for Neutrophil Elastase antibody 27642-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC

Cell Mol Biol Lett

Obacunone alleviates ferroptosis during lipopolysaccharide-induced acute lung injury by upregulating Nrf2-dependent antioxidant responses.

Authors - Jin Li
bovineIF

Animals (Basel)

Effects of Hormone, NEFA and SCFA on the Migration of Neutrophils and the Formation of Neutrophil Extracellular Traps in Dairy Cows.

Authors - Guanxin Lv
ratIHC

Front Pharmacol

RNA-sequencing approach for exploring the protective mechanisms of dexmedetomidine on pancreatic injury in severe acute pancreatitis

Authors - Jiaqi Yao

Sci Rep

Neutrophil extracellular traps exacerbate liver ischemia-reperfusion injury by promoting macrophage M1 polarization via the cGAS-STING pathway.

Authors - Dingheng Hu
humanWB

bioRxiv

Extracellular Vesicle-Associated Neutrophil Elastase Activates Hepatic Stellate Cells and Promotes Liver Fibrogenesis via ERK1/2 Pathway

Authors - Regina Oshins

ACS Appl Mater Interfaces

Ferritin Nanoparticle-Mediated Sustained Delivery of Sivelestat with Poor Water Affinity Attenuates Acute Lung Injury via Dual Inhibition of NETs and Pyroptosis.

Authors - Hui Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Clotilde (Verified Customer) (07-13-2026)

This Elastase works perfectly in IF-P. The IF was performed on FFPE human tonsil tissue slide with Dako antigen retrival pH9. Primary incubation was performed at 1:100 overnight (16h) at 4°C. Secondary incubation was performed with Goat anti-Rabbit at 1:1000 for 1h at RT. Image were taken with a Leica THUNDER at 10x and 20x magnification.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 100
  • Cell Tissue Type: Spleen
Neutrophil Elastase Antibody Immunofluorescence validation (100 dilution) in Spleen (Cat no:27642-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...