Tested Applications
| Positive WB detected in | MCF-7 cells, mouse brain tissue, mouse testis tissue, SKOV-3 cells, PC-3 cells, SH-SY5Y cells, NIH/3T3 cells, mouse ovary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14007-1-AP targets ESR2 in WB, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, chicken, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5103 Product name: Recombinant human ESR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC024181 Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA Predict reactive species |
| Full Name | estrogen receptor 2 (ER beta) |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | BC024181 |
| Gene Symbol | ESR2 |
| Gene ID (NCBI) | 2100 |
| RRID | AB_2102386 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q92731 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Estrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. ESR2 exists various isoforms and range of calculated molecular weight of isoforms is 50-60 kDa. The experiment detected two bands for ESR2 in isolated human germ cells, one at 60 kDa and a weaker one at 50 kDa(PMID:14766008).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for ESR2 antibody 14007-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ERβ (Estrogen Receptor Beta) antibody (Cat# 14007-1-AP) has 89 citations across journals including ACS Nano, Redox Biology, Cell Death & Disease, Journal of Experimental & Clinical Cancer Research, Human Reproduction, FASEB Journal, and Journal of Ethnopharmacology. Research fields span oncology (lung, breast, colorectal, ovarian cancers), reproductive biology (endometriosis, PCOS), bone metabolism, neuroprotection, environmental toxicology, and drug delivery.
| Species | Application | Title |
|---|---|---|
ACS Nano Clinically Validated Leptin Receptor as a Target for Liposomal Delivery of Metformin in Endometriosis Therapy. | ||
Redox Biol Lipoxin A4 ameliorates knee osteoarthritis progression in rats by antagonizing ferroptosis through activation of the ESR2/LPAR3/Nrf2 axis in synovial fibroblast-like synoviocytes | ||
J Biomed Sci Dioscin promotes osteoblastic proliferation and differentiation via Lrp5 and ER pathway in mouse and human osteoblast-like cell lines. | ||
J Exp Clin Cancer Res 17β-estradiol upregulates IL6 expression through the ERβ pathway to promote lung adenocarcinoma progression. | ||
Environ Sci Technol Bisphenol A Disrupts Spermatogenesis via Excessive Mitophagy-Driven Ferroptosis. |
Reviews
What customers say
Two reviews were found for this product. One user (IF, mouse brain frozen sections) rated it 1/5, reporting non-specific cytoplasmic staining when only nuclear signal was expected, and additionally observed signal in ESR2 knockout tissue, raising concerns about specificity. The other user (Western Blot) rated it 4/5 but provided no written comments. Overall, feedback is mixed, with one positive WB result and one negative IF experience highlighting potential specificity issues in immunofluorescence applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Anna (Verified Customer) (10-04-2022) | No specific reaction - positive reaction should be visible only in nucleus but in our staining is present also in the cytoplasm. Moreover, we used the material from knockout mice without ESR2 and we observed response in this slices to this receptor. I have a problem with attaching a photo file. Please check the file below. https://drive.google.com/file/d/15d3t6thx7rcWyN-_DkkKCtpAMyi8jxHO/view
|
Kenneth (Verified Customer) (01-08-2020) | N/A
|
