Tested Applications
| Positive WB detected in | human brain tissue | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17456-1-AP targets FABP7 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag10990 Product name: Recombinant human FABP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC012299 Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Predict reactive species | 
                                    
| Full Name | fatty acid binding protein 7, brain | 
| Calculated Molecular Weight | 132aa,15 kDa; 166aa,19 kDa | 
| Observed Molecular Weight | 15 kDa | 
| GenBank Accession Number | BC012299 | 
| Gene Symbol | FABP7 | 
| Gene ID (NCBI) | 2173 | 
| RRID | AB_2100357 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O15540 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
FABP7 (Fatty Acid Binding Protein-7), also known as B-FABP (Brain Fatty Acid-Binding Protein), is a member of FABP family which are intracellular proteins involved in lipid metabolism. Normally FABP7 is mainly expressed in brain and other neural tissues and is important in early nervous system development. In addition, FABP7 is considered a marker for some brain tumors and may have a role in tumorigenesis in the peripheral nervous system and in several extra nervous system neoplasms such as breast cancer, renal cancer, and melanoma. This antibody was raised against the full-length human FABP7 and may cross-react with other FABPs.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FABP7 antibody 17456-1-AP | Download protocol | 
| WB protocol for FABP7 antibody 17456-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 





