Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Piezo1 (extracellular domain) Polyclonal antibody

Piezo1 (extracellular domain) Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15939-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (5)

Applications

WB, IHC, IF/ICC, CoIP, ELISA

FAM38A, PIEZO1, KIAA0233, Membrane protein induced by beta-amyloid treatment, Piezo-type mechanosensitive ion channel component 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SGC-7901 cells, hTERT-RPE1 cells
Positive IHC detected inhuman skin tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15939-1-AP targets Piezo1 (extracellular domain) in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat, pig, canine, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7791

Product name: Recombinant human FAM38A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 67-373 aa of BC008073

Sequence: SVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKHHGAVRVHRAGHRQVRARILQRDLALHYVRGAAVRGPHPQALPGHLPGAGDSGAGAGGGVVCQAHLPLPLTGDHDQVDS

Predict reactive species
Full Name family with sequence similarity 38, member A
Calculated Molecular Weight 286 kDa
Observed Molecular Weight 233-286 kDa
GenBank Accession NumberBC008073
Gene Symbol Piezo1/FAM38A
Gene ID (NCBI) 9780
RRIDAB_2231460
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92508
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mechanotransduction, the conversion of mechanical force into biological signals, is a fundamental physiologic process of mammalian cells that influences many critical processes including embryonic development, tactile, pain, and auditory sensation, regulation of vascular tone, flow sensing in the kidney, and muscle and tendon stretch. FAM38A, also known as Piezo1, has recently been identified as a mechanotransduction protein that gets involved in mechanosensation and stretch-activated cation channel activation. Piezo1 also plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER. Mutations in the gene encoding Piezo1 are associated with hereditary xerocytosis. Piezo1 also regulates extrusion to maintain homeostatic epithelial cell numbers. This antibody was raised against the extracellular domain of human Piezo1. (PMID: 20016066, 28416610)

Protocols

Product Specific Protocols
IF protocol for Piezo1 (extracellular domain) antibody 15939-1-APDownload protocol
IHC protocol for Piezo1 (extracellular domain) antibody 15939-1-APDownload protocol
WB protocol for Piezo1 (extracellular domain) antibody 15939-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
zebrafishIF

Nature

Skin cells undergo asynthetic fission to expand body surfaces in zebrafish.

Authors - Keat Ying Chan
  • KO Validated
zebrafish,mouseWB

Nature

Crowding induces live cell extrusion to maintain homeostatic cell numbers in epithelia.

Authors - Eisenhoffer George T GT
  • KD Validated
humanWB

Nature

Piezo1 integration of vascular architecture with physiological force.

Authors - Jing Li
  • KD Validated
zebrafish,canineWB,IF

Nature

Mechanical stretch triggers rapid epithelial cell division through Piezo1.

Authors - S A Gudipaty
  • KO Validated
mouseIHC

Cell

RNA Sensing by Gut Piezo1 Is Essential for Systemic Serotonin Synthesis.

Authors - Erika Sugisawa
humanWB

Blood

Mechanosensation by endothelial PIEZO1 is required for leukocyte diapedesis.

Authors - ShengPeng Wang
  • KD Validated

Reviews

    3.8 out of 5
Add a review

10 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Yao (Verified Customer) (09-24-2025)

I used this antibody for the kidney slides of wild-type mice, it showed positive staining that matches the expected pattern

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Kidney
Piezo1 (extracellular domain) Antibody Immunohistochemistry validation (1:100 dilution) in Kidney (Cat no:15939-1-AP)

Hyun (Verified Customer) (07-23-2025)

This antibody works well for western blot.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: rat brain tissue

Jason (Verified Customer) (02-11-2025)

The antibody works well. However, due to the large protein size, obtaining sharp and clean Western blot bands is challenging for me. In fluorescence staining, the knockout cells were stained similarly to the control cells, suggesting non-specific staining in IF.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:500 for WB; 1:200 for IF
  • Cell Tissue Type: Human Dermal Microvascular Endothelial Cell
Piezo1 (extracellular domain) Antibody Western Blot,Immunofluorescence validation (1:500 for WB; 1:200 for IF dilution) in Human Dermal Microvascular Endothelial Cell (Cat no:15939-1-AP)

Hyojin (Verified Customer) (01-19-2024)

I like the quality of antibody. Thank you for generating.

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1:200 for IF 1:1000 for WB
  • Cell Tissue Type: mouse/human

Sammy (Verified Customer) (12-04-2023)

Ab detects a band at the correct size but the signal is weak. This works only when detected via HRP/Chemi. NIR-conjugated antibodies do not detect this band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: HUVEC
Piezo1 (extracellular domain) Antibody Western Blot validation (1 in 1000 dilution) in HUVEC (Cat no:15939-1-AP)

Xiaonan (Verified Customer) (02-01-2023)

We did not see the band for Piezol.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse kidney
Piezo1 (extracellular domain) Antibody Western Blot validation (1:1000 dilution) in mouse kidney (Cat no:15939-1-AP)

LUNFENG (Verified Customer) (01-27-2020)

GOOD

  • Applications: Immunofluorescence,
  • Cell Tissue Type: HEART

Jie (Verified Customer) (01-23-2020)

Works with one band. Due to the large protein size, band does not always show sharp image.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hela cells

Canzhao (Verified Customer) (01-17-2020)

It worked in western blot and showed nice band.

  • Applications: Western Blot,
  • Cell Tissue Type: Mouse heart tissue

Zeinab (Verified Customer) (09-27-2019)

Worked great, Clean and Specific

  • Applications: Western Blot, Immunofluorescence,
  • Cell Tissue Type: Human Cardiac Microvascular Endothelial cells
Loading...
||
New chat

Able

正在加载,请稍候...