CD64 Polyclonal antibody

• 

  WB analysis using 27563-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 27563-1-AP (CD64 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 27563-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 27563-1-AP (CD64 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 27563-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 27563-1-AP (CD64 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of THP-1 using 27563-1-AP

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using CD64 antibody (27563-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

CD64 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27563-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CD64A, Fc gamma RI, Fc gamma RIA, FCG1, Fc-gamma RI

---

Tested Applications

• Positive WB detected in: THP-1 cells, U-937 cells, HL-60 cells
• Positive IF/ICC detected in: THP-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27563-1-AP targets CD64 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26727

  Product name: Recombinant human FCGR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-374 aa of BC032634

  Sequence: VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT

• Full Name: Fc fragment of IgG, high affinity Ia, receptor (CD64)
• Calculated Molecular Weight: 374 aa, 43 kDa
• Observed Molecular Weight: 65-70 kDa, 43-45 kDa
• GenBank Accession Number: BC032634
• Gene Symbol: FCGR1A
• Gene ID (NCBI): 2209
• ENSEMBL Gene ID: ENSG00000150337
• RRID: AB_2880909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P12314
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fcγ receptor comprise a multigene family of integral membrane glycoproteins that exhibit complex activation or inhibitory effects on cell functions after aggregation by complexed immunoglobulin G (IgG) (PMID: 17005690 ). CD64, also known as FcγRIA, is a high affinity receptor for the Fc region of IgG. It is expressed by monocytes/macrophages, activated neutrophils, dendritic cells, and early myeloid cells (PMID: 23293080; 19642859; 7680917). CD64 functions in both innate and adaptive immune responses. The calculated molecular weight of CD64 is 43 kDa, while the glycosylated CD64 has a higher apparent molecular weight.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Cancer Cell-Derived Exosomes Promote HCC Tumorigenesis Through Hedgehog Pathway.; Authors - Li Li