Tested Applications
| Positive WB detected in | HEK-293 cells, human placenta tissue, mouse lung tissue |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13687-1-AP targets VEGFR-1/FLT-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine, deer |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4558 Product name: Recombinant human VEGFR1, FLT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-300 aa of BC039007 Sequence: TGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK Predict reactive species |
| Full Name | fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) |
| Calculated Molecular Weight | 1338 aa, 151 kDa |
| Observed Molecular Weight | 55-60 kDa |
| GenBank Accession Number | BC039007 |
| Gene Symbol | VEGFR-1/FLT-1 |
| Gene ID (NCBI) | 2321 |
| RRID | AB_10644337 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17948 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Vascular endothelial growth factor receptor-1 (VEGFR-1, FLT-1) is a receptor tyrosine kinase belonging to the VEGFR family. VEGF is a key regulator of physiological angiogenesis and has also been implicated in pathological angiogenesis associated with tumors, intraocular neovascular disorders, and other conditions. The biological effects of VEGF are mediated by VEGFR-1 and VEGFR-2. Both the two receptors have seven immunoglobulin-like repeats in the extracellular domain, a single transmembrane region and a tyrosine kinase domain. VEGFR-1 binds VEGFA, PIGF, and VEGFB, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Two isoforms of VEGFR-1 exist, a full-length transmembrane form and a short soluble form (sVEGFR-1) consisting of only the extracellular ligand-binding domain. (PMID: 12778165; 17109193; 8806634)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| IHC protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| IP protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| WB protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VEGFR-1/FLT-1 Polyclonal antibody (Cat# 13687-1-AP) has accumulated 82 citations in journals including Cell, Advanced Science, EMBO Reports, FASEB Journal, Cancer Letters, Hypertension, Stem Cell Research & Therapy, and Clinical Cancer Research. Research fields encompass angiogenesis, preeclampsia, multiple cancer types (breast, liver, renal, esophageal), wound healing, cardiovascular disease, neuroprotection, stem cell therapy, and vascular biology. Primary applications include WB, IHC, IF, FC, and IP.
| Species | Application | Title |
|---|---|---|
Bioact Mater Mantis shrimp saddle-mimetic amorphous calcium (zinc) phosphate/chitin scaffolds with superior mechanical properties and bioactivity for bone regeneration. | ||
Adv Sci (Weinh) 4-Octyl Itaconate Alleviates Myocardial Ischemia-Reperfusion Injury Through Promoting Angiogenesis via ERK Signaling Activation | ||
Adv Sci (Weinh) BEST1 Positive Monocytes in Circulation: Visualize Intratumoral Crosstalk between Cancer Cells and Monocytes | ||
Adv Sci (Weinh) Brd4 BD1 Domain Antagonism of MS436 Preserves Blood-Brain Barrier Integrity via Rnf43/β-Catenin Signaling Pathway. | ||
Cell Rep Med Design optimization of antibody-ligand motifs to enhance CAR-T redirection activity against solid tumors. |
