Fascin Polyclonal antibody

• 

  WB analysis using 14384-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14384-1-AP (Fascin antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14384-1-AP

  WB result of Fascin antibody (14384-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Fascin transfected HeLa cells.

• 

  WB analysis using 14384-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14384-1-AP (Fascin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 14384-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14384-1-AP (Fascin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 14384-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 14384-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14384-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:400 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 14384-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 14384-1-AP (Fascin antibody) at dilution of 1:400 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse brain using 14384-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 14384-1-AP (Fascin antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse brain using 14384-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 14384-1-AP (Fascin antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of U-87 MG using 14384-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using Fascin antibody (14384-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  FC experiment of SH-SY5Y using 14384-1-AP

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.2 ug Anti-Human Fascin (14384-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.2 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with 0.1% TritonX-100.

• Featured Product
• KD/KO Validated

Fascin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Cat No. 14384-1-AP

Publications(13)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

Synonyms

FSCN1, 55 kDa actin bundling protein, 55 kDa actin-bundling protein, FAN1, Fascin 1,Fascin

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse thymus tissue, K-562 cells, NIH/3T3 cells, SH-SY5Y cells, SK-N-SH cells
• Positive IHC detected in: human tonsillitis tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue
• Positive IF/ICC detected in: U-87 MG cells
• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 10 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

14384-1-AP targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5816

  Product name: Recombinant human Fascin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC000521

  Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS

• Full Name: fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC000521
• Gene Symbol: Fascin
• Gene ID (NCBI): 6624
• ENSEMBL Gene ID: ENSG00000075618
• RRID: AB_2106381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16658
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Clin Transl Med; Parkin regulates IGF2BP3 through ubiquitination in the tumourigenesis of cervical cancer; Authors - Xin Sun
mouse	WB,IF	Ecotoxicol Environ Saf; Prenatal Perfluorooctanoic Acid (PFOA) exposure causes reproductive toxicity by disrupting the formation of transzonal projections (TZPs) and down-regulating Wnt4/β-catenin signaling pathway in progeny; Authors - Hua Du
human	WB	Aging (Albany NY); Exosomal lncRNA LINC01711 facilitates metastasis of esophageal squamous cell carcinoma via the miR-326/FSCN1 axis.; Authors - Mei-Ling Xu
human	WB	Int J Biol Macromol; Recombinant porcine NK-lysin inhibits the invasion of hepatocellular carcinoma cells in vitro.; Authors - Ajab Khan
human	WB	Exp Cell Res; Downregulation of fascin in the first trimester placental villi is associated with early recurrent miscarriage.; Authors - Jones Lamptey ; KD Validated
human	WB	J Exp Clin Cancer Res; The role of microRNA-133b and its target gene FSCN1 in gastric cancer.; Authors - Lihua Guo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ryan (Verified Customer) (01-24-2018)

Antigen retrieval NaCit 0.1M ph6

• Applications: Immunohistochemistry,
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Retina/Brain

Fascin Antibody Immunohistochemistry, validation (1:100 dilution) in Retina/Brain (Cat no:14384-1-AP)