Tested Applications
| Positive WB detected in | HeLa cells, mouse thymus tissue, K-562 cells, NIH/3T3 cells, SH-SY5Y cells, SK-N-SH cells |
| Positive IHC detected in | human tonsillitis tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | U-87 MG cells |
| Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 ul suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14384-1-AP targets Fascin in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5816 Product name: Recombinant human Fascin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-187 aa of BC000521 Sequence: MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAVCLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQTVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLAFQDQRYS Predict reactive species |
| Full Name | fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus) |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC000521 |
| Gene Symbol | Fascin |
| Gene ID (NCBI) | 6624 |
| ENSEMBL Gene ID | ENSG00000075618 |
| RRID | AB_2106381 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16658 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fascin is a highly conserved and ubiquitous actin cross-linking protein that has a major function in cell motility and adhesion. Fascin localizes to a number of highly dynamic cellular structures that require strong mechanical support which include stress fibers and cellular protrusions such as microvilli, microspikes and lamellipodia. Fascin is up-regulated in many human carcinomas. It's a marker for Reed-Sternberg cells in Hodgkin's disease; it is also a highly selective marker for dendritic cells of lymphoid tissues.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Fascin antibody 14384-1-AP | Download protocol |
| IF protocol for Fascin antibody 14384-1-AP | Download protocol |
| IHC protocol for Fascin antibody 14384-1-AP | Download protocol |
| WB protocol for Fascin antibody 14384-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Fascin Polyclonal antibody (Cat# 14384-1-AP) has 20 citations published in journals including Adv Sci, Sci Adv, J Exp Clin Cancer Res, Br J Cancer, Mol Biol Cell, J Invest Dermatol, Clin Transl Med, Aging, Brain Res Bull, Biomedicines, Exp Cell Res, Immunol Lett, Hum Cell, J Anat, Ecotoxicol Environ Saf, Int J Biol Macromol, Acta Biochim Biophys Sin, and bioRxiv. Research fields span cancer (gastric, cervical, prostate, esophageal, testicular), wound healing, neuroinflammation, diabetic nephropathy, reproductive biology, cell mechanics, and proteomics.
| Species | Application | Title |
|---|---|---|
J Exp Clin Cancer Res The role of microRNA-133b and its target gene FSCN1 in gastric cancer. | ||
Adv Sci (Weinh) Beyond Catalytic Therapy: Copper-Paeonol Nanozymes Disrupt Fascin-Mediated Actin Bundling to Suppress Tumor Growth and Metastasis. | ||
Adv Sci (Weinh) The Histone Lysine Demethylase KDM7A Contributes to Reward Memory via Fscn1-Induced Synaptic Plasticity in the Medial Prefrontal Cortex | ||
Adv Sci (Weinh) Cockroach-Derived Leucokinin VIII Peptide Accelerates Diabetic Skin Wound Healing by Enhancing Keratinocyte Filopodia Formation. | ||
Int J Biol Macromol Recombinant porcine NK-lysin inhibits the invasion of hepatocellular carcinoma cells in vitro. |
Reviews
What customers say
Able is busy answering your previous question. Please try again later.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura Balus (Verified Customer) (12-22-2025) | The antibody of fascin is very good
|
Ryan (Verified Customer) (01-24-2018) | Antigen retrieval NaCit 0.1M ph6
 |
