• Featured Product
  • KD/KO Validated

FUS/TLS Monoclonal antibody

FUS/TLS Monoclonal Antibody for WB, IP, IF, IHC, ELISA

Cat No. 60160-1-Ig
Clone No.3A10B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IP, IF, RIP, IHC, ELISA

75 kDa DNA pairing protein, FUS, FUS CHOP, FUS1, FUS-CHOP, hnRNP P2, Oncogene FUS, Oncogene TLS, POMp75, RNA binding protein FUS, TLS, TLS/CHOP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, HL-60 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman gliomas tissue, human colon tissue, human brain (FTLD) tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60160-1-Ig targets FUS/TLS in WB, IP, IF, RIP, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, Drosophila
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2150

Product name: Recombinant human FUS/TLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-400 aa of BC026062

Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

Predict reactive species
Full Name fusion (involved in t(12;16) in malignant liposarcoma)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight68-75 kDa
GenBank Accession NumberBC026062
Gene Symbol FUS/TLS
Gene ID (NCBI) 2521
RRIDAB_10666169
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35637
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration. Two research groups simultaneously reported that FUS is present in 5% of the pathalogical aggregations (inclusions) seen in familial amyotrophic sclerosis (fALS). FUS-positive inclusions were also reported in cases of sporadic ALS (sALS). More recently, wild-type FUS has also been implicated in the pathological development of frototemporal lobar dementia (FTLD) with ubiquitin-positive inclusions (FTLD-U), further linking FUS to the pathogenesis of neurogenerative diseases. There is some debate as to whether FUS colocalizes with TDP-43 in TDP-43-positive cases of ALS and whether TDP-43 and FUS cause neurodegenerative disease independently or contributively of one another. This antibody is a mouse monoclonal antibody raised against an internal region of human FUS. Initial reports from our customers suggest this new monoclonal FUS antibody (60160-1-Ig) is a useful tool in ALS and FTLD research. For more details, please see our blog article regarding the matter.

Publications

SpeciesApplicationTitle
WB,IF

J Cell Biol

The RNA-binding protein Fus directs translation of localized mRNAs in APC-RNP granules.

Authors - Yasuda Kyota K
  • KD Validated

Brain

Motor neuron degeneration in spastic paraplegia 11 mimics amyotrophic lateral sclerosis lesions.

Authors - Paola S Denora
humanIHC

Acta Neuropathol

Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations.

Authors - Neumann Manuela M
humanWB,IF

Ann Neurol

A Novel Missense Mutation of CMT2P Alters Transcription Machinery.

Authors - Bo Hu
humanWB,IF

Cell Rep

A Wnt-induced lncRNA-DGCR5 splicing switch drives tumor-promoting inflammation in esophageal squamous cell carcinoma

Authors - Yue Li
humanIF

Acta Neuropathol Commun

RBM45 associates with nuclear stress bodies and forms nuclear inclusions during chronic cellular stress and in neurodegenerative diseases.

Authors - Mahlon Collins
Loading...
||
New chat

Able

正在加载,请稍候...