• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated FUS/TLS Monoclonal antibody

FUS/TLS Monoclonal Antibody for
Cat No. CL594-60160
Clone No.3A10B5

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

FUS, ALS6, ALS, 75 kDa DNA-pairing protein, 75 kDa DNA pairing protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL594-60160 targets FUS/TLS in applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag2150

Product name: Recombinant human FUS/TLS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-400 aa of BC026062

Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG

Predict reactive species
Full Name fusion (involved in t(12;16) in malignant liposarcoma)
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC026062
Gene Symbol FUS/TLS
Gene ID (NCBI) 2521
RRIDAB_2883430
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP35637
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration. Two research groups simultaneously reported that FUS is present in 5% of the pathalogical aggregations (inclusions) seen in familial amyotrophic sclerosis (fALS). FUS-positive inclusions were also reported in cases of sporadic ALS (sALS). More recently, wild-type FUS has also been implicated in the pathological development of frototemporal lobar dementia (FTLD) with ubiquitin-positive inclusions (FTLD-U), further linking FUS to the pathogenesis of neurogenerative diseases. There is some debate as to whether FUS colocalizes with TDP-43 in TDP-43-positive cases of ALS and whether TDP-43 and FUS cause neurodegenerative disease independently or contributively of one another. This antibody is a mouse monoclonal antibody raised against an internal region of human FUS. Initial reports from our customers suggest this new monoclonal FUS antibody (60160-1-Ig) is a useful tool in ALS and FTLD research. For more details, please see our blog article regarding the matter.

Loading...
||
New chat

Able

正在加载,请稍候...