Tested Applications
| Positive WB detected in | HCT 116 cells, Jurkat cells, K-562 cells, Raji cells, mouse liver tissue |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 20 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
14147-1-AP targets Frataxin in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5316 Product name: Recombinant human FXN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC048097 Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA Predict reactive species |
| Full Name | frataxin |
| Calculated Molecular Weight | 23 kDa |
| Observed Molecular Weight | 14-23 kDa |
| GenBank Accession Number | BC048097 |
| Gene Symbol | FXN |
| Gene ID (NCBI) | 2395 |
| RRID | AB_2231876 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16595 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Frataxin (FXN), also named as FRDA, X25, m81-FXN, d-FXN, m78-FXN and i-FXN, belongs to the frataxin family. It promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. FXN may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. FXN is cleaved to be 4 chains. FXN is expressed in the cytoplasm as a 210 amino acid (AA) precursor protein (pFXN; 23 KDa) that is translocated into mitochondria where it is processed by two consecutive steps into iFXN (FXN 42-210; 19 KDa) and finally mFXN (81-210; 14.2 KDa), which is functional. (PMID: 26704351, PMID: 26671574)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Frataxin antibody 14147-1-AP | Download protocol |
| WB protocol for Frataxin antibody 14147-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Blood Defective palmitoylation of transferrin receptor triggers iron overload in Friedreich ataxia fibroblasts. | ||
Neurobiol Dis Neurobehavioral deficits of mice expressing a low level of G127V mutant frataxin | ||
J Nutr Biochem Iron-frataxin involved in the protective effect of quercetin against alcohol-induced liver mitochondrial dysfunction | ||
Sci Rep Intrathecal delivery of frataxin mRNA encapsulated in lipid nanoparticles to dorsal root ganglia as a potential therapeutic for Friedreich's ataxia. | ||
Hum Mol Genet Premature transcription termination at the expanded GAA repeats and aberrant alternative polyadenylation contributes to the Frataxin transcriptional deficit in Friedreich's ataxia. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mariana (Verified Customer) (01-06-2021) | Failed to detect endogenous FXN in IPSC derived Cardiomyocytes from Friedreich Ataxia patients and controls.
|
FH Zhuqing (Verified Customer) (11-26-2020) | In mouse cells, it can detect mature frataxin.
|
FH Daniel (Verified Customer) (08-20-2019) | Works fine for WB in mouse brain and heart tissues.
|



