Tested Applications
| Positive WB detected in | HCT 116 cells, Jurkat cells, K-562 cells, Raji cells, mouse liver tissue |
| Positive IHC detected in | human heart tissue, human lung cancer tissue, mouse brain tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14147-1-AP targets Frataxin in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5316 Product name: Recombinant human FXN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC048097 Sequence: MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA Predict reactive species |
| Full Name | frataxin |
| Calculated Molecular Weight | 23 kDa |
| Observed Molecular Weight | 14-23 kDa |
| GenBank Accession Number | BC048097 |
| Gene Symbol | FXN |
| Gene ID (NCBI) | 2395 |
| RRID | AB_2231876 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16595 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Frataxin (FXN), also named as FRDA, X25, m81-FXN, d-FXN, m78-FXN and i-FXN, belongs to the frataxin family. It promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. FXN may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. FXN is cleaved to be 4 chains. FXN is expressed in the cytoplasm as a 210 amino acid (AA) precursor protein (pFXN; 23 KDa) that is translocated into mitochondria where it is processed by two consecutive steps into iFXN (FXN 42-210; 19 KDa) and finally mFXN (81-210; 14.2 KDa), which is functional. (PMID: 26704351, PMID: 26671574)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Frataxin antibody 14147-1-AP | Download protocol |
| WB protocol for Frataxin antibody 14147-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Frataxin Polyclonal antibody (catalog #14147-1-AP) has 27 citations. These appear in journals including Blood, Molecular Cell, Advanced Science, Brain, Cell Death & Disease, Cell Chemical Biology, Phytomedicine, Neurobiology of Disease, Human Molecular Genetics, iScience, and Scientific Reports, among others. The associated research fields center on Friedreich's ataxia, mitochondrial function and dysfunction, ferroptosis, oxidative stress, cardiomyopathy, neurodegeneration, and cancer (ovarian, bladder, colon), with most studies employing Western blot, plus IF, IHC, and Co-IP applications.
| Species | Application | Title |
|---|---|---|
Blood Defective palmitoylation of transferrin receptor triggers iron overload in Friedreich ataxia fibroblasts. | ||
Mol Cell Reactive oxygen species control protein degradation at the mitochondrial import gate | ||
Adv Sci (Weinh) Impaired Iron-Sulfur Cluster Synthesis Induces Mitochondrial PARthanatos in Diabetic Cardiomyopathy | ||
Cell Death Dis Human frataxin, the Friedreich ataxia deficient protein, interacts with mitochondrial respiratory chain | ||
Phytomedicine Salidroside inhibits doxorubicin-induced cardiomyopathy by modulating a ferroptosis-dependent pathway. |
Reviews
What customers say
The antibody received mixed feedback across three reviews. Two users reported successful Western Blot results in mouse tissues, with one noting it works well in mouse brain and heart at 1:1000 dilution, and another confirming detection of mature frataxin in C2C12 mouse myoblasts at 1:1000. However, one user reported failure to detect endogenous FXN in iPSC-derived cardiomyocytes from Friedreich Ataxia patients and controls at 1:500 dilution. Overall, the antibody performs reliably in mouse cell lines and tissues for WB, but may have limitations in detecting endogenous frataxin in human iPSC-derived cells.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mariana (Verified Customer) (01-06-2021) | Failed to detect endogenous FXN in IPSC derived Cardiomyocytes from Friedreich Ataxia patients and controls.
|
Zhuqing (Verified Customer) (11-26-2020) | In mouse cells, it can detect mature frataxin.
|
Daniel (Verified Customer) (08-20-2019) | Works fine for WB in mouse brain and heart tissues.
|
