Phospholemman/FXYD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Phospholemman/FXYD1 Polyclonal antibody (13721-1-AP)

Phospholemman/FXYD1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 13721-1-AP Copied!

Publications (27)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IP, IF, IHC, ELISA

Synonyms

FXYD1, Phospholemman, Phospholemman/FXYD1, PLM

• 

  WB analysis of human skeletal muscle using 13721-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 13721-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13721-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat heart using 13721-1-AP

  rat heart tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat skeletal muscle using 13721-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 13721-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 13721-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 13721-1-AP

  IP result of anti-Phospholemman/FXYD1 (IP:13721-1-AP, 4ug; Detection:13721-1-AP 1:500) with mouse heart tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 13721-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 13721-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 13721-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 13721-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 13721-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 13721-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 13721-1-AP (Phospholemman/FXYD1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Phospholemman/FXYD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat heart tissue, mouse heart tissue, mouse kidney tissue, human brain tissue
• Positive IP detected in: mouse heart tissue
• Positive IHC detected in: mouse heart tissue, human skeletal muscle tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1500
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13721-1-AP targets Phospholemman/FXYD1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4669

  Product name: Recombinant human FXYD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC032800

  Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR

• Full Name: FXYD domain containing ion transport regulator 1
• Calculated Molecular Weight: 92 aa, 10 kDa
• Observed Molecular Weight: 10-15 kDa
• GenBank Accession Number: BC032800
• Gene Symbol: FXYD1
• Gene ID (NCBI): 5348
• RRID: AB_2108296
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00168
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224)

Publications

What published studies show

The anti-FXYD1 (Phospholemman) antibody (Cat# 13721-1-AP) has 27 citations across 15 journals, including J Physiol, J Appl Physiol, Am J Physiol Cell Physiol, Sci Rep, J Biol Chem, Front Physiol, PLoS One, and Scand J Med Sci Sports. Research fields span skeletal muscle physiology, exercise and sports science, Na,K-ATPase regulation, cardiac electrophysiology, diabetes, and neurological disorders.

Automatically generated from the 27 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Am J Physiol Cell Physiol; Phospholemman is not required for the acute stimulation of Na,K-ATPase α2 activity during skeletal muscle fatigue.; Authors - Palanikumar Manoharan
mouse	WB	Am J Physiol Cell Physiol; Isoform-specific Na,K-ATPase and membrane cholesterol remodeling in motor endplates in distinct mouse models of myodystrophy.; Authors - Violetta V Kravtsova
mouse	WB,IF	Sci Rep; Over-expression of microRNA-1 causes arrhythmia by disturbing intracellular trafficking system.; Authors - Xiaomin Su
rat	WB	J Physiol; Fatigue-induced change in T-system excitability and its major cause in rat fast-twitch skeletal muscle in vivo.; Authors - Daiki Watanabe
human	WB	J Physiol; Fibre type-specific change in FXYD1 phosphorylation during acute intense exercise in humans.; Authors - Thomassen Martin M
human	WB	J Physiol; Cycling with blood flow restriction improves performance and muscle K+ regulation and alters the effect of anti-oxidant infusion in humans.; Authors - Danny Christiansen