GSTM3 Polyclonal antibody

• 

  WB analysis using 15214-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15214-1-AP (GSTM3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 15214-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 15214-1-AP (GSTM3 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 15214-1-AP

  IP result of anti-GSTM3 (IP:15214-1-AP, 4ug; Detection:15214-1-AP 1:300) with mouse testis tissue lysate 4000ug.

• 

  IHC staining of mouse testis using 15214-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15214-1-AP (GSTM3 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 15214-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 15214-1-AP (GSTM3 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 15214-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 15214-1-AP (GSTM3 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human testis using 15214-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 15214-1-AP (GSTM3 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 15214-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using GSTM3 antibody (15214-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

GSTM3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15214-1-AP

Publications(20)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

GST5, GST class-mu 3, GST class mu 3, Glutathione S-transferase Mu 3, Glutathione S transferase Mu 3

---

Tested Applications

• Positive WB detected in: mouse testis tissue, human testis tissue, rat testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: mouse testis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 16 publications below
• IHC: See 7 publications below

Product Information

15214-1-AP targets GSTM3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7375

  Product name: Recombinant human GSTM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC000088

  Sequence: MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC

• Full Name: glutathione S-transferase mu 3 (brain)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-29 kDa
• GenBank Accession Number: BC000088
• Gene Symbol: GSTM3
• Gene ID (NCBI): 2947
• RRID: AB_2116070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P21266
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GSTM3 is a cytosolic enzyme involved in prostaglandin and leukotriene synthesis and in the metabolization of toxic compounds, such as chemotherapeutic drugs, insecticides, herbicides, carcinogens, and by-products of oxidative stress. GSTM3 is expressed in testis, brain, lung, and lymphocytes. GSTM3 have been reported to be dysregulated in cancers like prostate cancer and colon cancer.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell Metab; TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.; Authors - Dong Huang
human	WB	Mol Cell; SMURF2 predisposes cancer cell toward ferroptosis in GPX4-independent manners by promoting GSTP1 degradation; Authors - Wenxin Zhang
human	WB	Nat Chem Biol; Enhanced mapping of small-molecule binding sites in cells; Authors - Jacob M Wozniak
		Cell Syst; Rare Disease Mechanisms Identified by Genealogical Proteomics of Copper Homeostasis Mutant Pedigrees.; Authors - Stephanie A Zlatic
human	WB,IHC	Cancer Lett; GSTM3 deficiency impedes DNA mismatch repair to promote gastric tumorigenesis via CAND1/NRF2-KEAP1 signaling.; Authors - Tao Chen ; KD Validated
mouse	WB	Part Fibre Toxicol; Protein target identification and toxicological mechanism investigation of silver nanoparticles-induced hepatotoxicity by integrating proteomic and metallomic strategies.; Authors - Ming Xu