Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells, mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat liver tissue |
| Positive IHC detected in | human stomach tissue, human colon, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 8 publications below |
| IHC | See 2 publications below |
Product Information
29091-1-AP targets HADHB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30298 Product name: Recombinant human HADHB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 34-262 aa of BC017564 Sequence: RAAPAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLL Predict reactive species |
| Full Name | hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme A thiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit |
| Calculated Molecular Weight | 51 kDa |
| Observed Molecular Weight | 52 kDa |
| GenBank Accession Number | BC017564 |
| Gene Symbol | HADHB |
| Gene ID (NCBI) | 3032 |
| RRID | AB_2918233 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55084 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HADHB, also named as TP- beta, Acetyl-CoA acyltransferase and Beta-ketothiolase, is a mitochondrial trifunctional enzyme subunit beta. Mitochondrial trifunctional enzyme catalyzes the last three of the four reactions of the mitochondrial beta-oxidation pathway. The mitochondrial beta-oxidation pathway is the major energy-producing process in tissues and is performed through four consecutive reactions breaking down fatty acids into acetyl-CoA. Among the enzymes involved in this pathway, the trifunctional enzyme exhibits specificity for long-chain fatty acids. Mitochondrial trifunctional enzyme is a heterotetrameric complex composed of two proteins, the trifunctional enzyme subunit alpha/HADHA carries the 2,3-enoyl-CoA hydratase and the 3-hydroxyacyl-CoA dehydrogenase activities, while the trifunctional enzyme subunit beta/HADHB described here bears the 3-ketoacyl-CoA thiolase activity. HADHB has 2 isoforms produced by alternative splicing with the MW of 49 kDa and 51 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HADHB antibody 29091-1-AP | Download protocol |
| WB protocol for HADHB antibody 29091-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Targeting Erbin-mitochondria axis in platelets/megakaryocytes promotes B cell-mediated antitumor immunity | ||
Biology (Basel) In Situ Peroxidase Labeling Followed by Mass-Spectrometry Reveals TIA1 Interactome. | ||
Ecotoxicol Environ Saf DNA demethylase TET2-mediated reduction of HADHB expression contributes to cadmium-induced malignant progression of colorectal cancer
| ||
Cell MTFP1 controls mitochondrial fusion to regulate inner membrane quality control and maintain mtDNA levels | ||
Basic Res Cardiol Comparison of the stage-dependent mitochondrial changes in response to pressure overload between the diseased right and left ventricle in the rat | ||
Cell Death Differ LncRNA BCAN-AS1 stabilizes c-Myc via N6-methyladenosine-mediated binding with SNIP1 to promote pancreatic cancer |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH bakar (Verified Customer) (02-10-2026) | Pour l’analyse de l’expression de la sous-unité β de l’enzyme mitochondrial HADHB, nous avons utilisé un anticorps polyclonal anti-HADHB (Proteintech, réf. 29091-1-AP). Cet anticorps a été sélectionné pour sa validation dans des applications de western blot (WB), immunohistochimie (IHC) et ELISA et pour sa reconnaissance de la cible chez plusieurs espèces (dont humain, souris et rat). Étant un anticorps polyclonal, il reconnaît plusieurs épitopes de la protéine cible, ce qui peut améliorer la sensibilité de détection tout en nécessitant une optimisation des conditions d’incubation et des contrôles appropriés pour minimiser les signaux non spécifiques. Les conditions expérimentales (dilutions, tampons de blocage et restaurations d’antigène) ont été optimisées empiriquement pour chaque application, et des contrôles positifs et négatifs ont été inclus pour assurer la spécificité des signaux observés.
|
