TIM3 Polyclonal antibody

TIM3 Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 11872-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

CD366, HAVCR2, HAVcr-2, T-cell immunoglobulin and mucin domain-containing protein 3, T-cell immunoglobulin mucin receptor 3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPC-3 cells, RAW 264.7 cells
Positive IHC detected inhuman tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11872-1-AP targets TIM3 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2459

Product name: Recombinant human HAVCR2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC020843

Sequence: MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPGEWTFACHLYE

Predict reactive species
Full Name hepatitis A virus cellular receptor 2
Calculated Molecular Weight 301 aa, 33 kDa
Observed Molecular Weight 50-70 kDa, 33 kDa
GenBank Accession NumberBC020843
Gene Symbol TIM3
Gene ID (NCBI) 84868
RRIDAB_10734330
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TDQ0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIM3, also known as HAVCR2, is a member of the recently discovered T cell Ig and mucin domain-containing molecule superfamily. TIM3 is a negative regulatory molecule that is important for T cell tolerance and has a crucial role in autoimmunity and T cell exhaustion during chronic viral infection (PMID: 23180819). TIM3 is expressed by T-helper type 1 (Th1) cells, macrophage, monocyte, dendritic cells, CD8+ T cell and other lymphocyte subsets. Galectin-9 is a ligand for TIM3. TIM3-galectin-9 pathway negatively regulates T helper type 1 immunity (PMID: 16286920). TIM3 is a 280-aa membrane protein with a calculated molecular weight of 33 kDa, the higher molecular weights between 50 and 70 kDa probably represent glycosylated TIM3 (PMID: 20107545; 17069754; 11725301)

Protocols

Product Specific Protocols
WB protocol for TIM3 antibody 11872-1-APDownload protocol
IHC protocol for TIM3 antibody 11872-1-APDownload protocol
IF protocol for TIM3 antibody 11872-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Front Mol Neurosci

Galectin-9/Tim-3 pathway mediates dopaminergic neurodegeneration in MPTP-induced mouse model of Parkinson’s disease

Authors - Qinyu Peng
humanWB

Front Cell Infect Microbiol

The Role of Tim-3 on dNK Cells Dysfunction During Abnormal Pregnancy With Toxoplasma gondii Infection.

Authors - Teng Li
humanIHC

CNS Neurosci Ther

PTX3 mediates the infiltration, migration, and inflammation-resolving-polarization of macrophages in glioblastoma.

Authors - Hao Zhang

Int J Oncol

Role of downregulation of galectin-9 in the tumorigenesis of gastric cancer.

Authors - Jiaxing Yang
mouseWB

Iran J Immunol

The Immunomodulatory Effects and Mechanisms of Tim-3 Action in the Early Stage of Mice with Severe Acute Pancreatitis.

Authors - Min Lin
humanWB

Immun Inflamm Dis

Galectin-9 and myeloid-derived suppressor cell as prognostic indicators for chronic lymphocytic leukemia

Authors - Xierenguli Alimu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Qing (Verified Customer) (06-10-2022)

It work nicely

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse
Loading...
||
New chat Able
正在加载,请稍候...