• Featured Product
  • KD/KO Validated

HMGB2 Polyclonal antibody

HMGB2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA
Cat No. 14597-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

HMG-2, HMG2, HMG 2, High mobility group protein B2, High mobility group protein 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, HL-60 cells, human cerebellum tissue, K-562 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14597-1-AP targets HMGB2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6135

Product name: Recombinant human HMGB2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 44-207 aa of BC001063

Sequence: KCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDED

Predict reactive species
Full Name high-mobility group box 2
Calculated Molecular Weight 24 kDa
Observed Molecular Weight 33-35 kDa
GenBank Accession NumberBC001063
Gene Symbol HMGB2
Gene ID (NCBI) 3148
RRIDAB_2117919
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP26583
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

High mobility group protein B2 (HMGB2) belongs to a family of highly conserved proteins that contain HMG box domains (11246022,14871457). All three family members (HMGB1, HMGB2, and HMGB3) contain two HMG box domains and a C-terminal acidic domain. HMGB1 is a widely expressed and highly abundant protein (14871457). HMGB2 is widely expressed during embryonic development, but it is restricted to lymphoid organs and testis in adult animals (11262228). HMGB3 is only expressed during embryogenesis (9598312). While expression varies, the biochemical properties of the different family members may be indistinguishable. The HMG box domains facilitate the binding of HMGB proteins to the minor groove of DNA, which results in local bending of the DNA double helix . HMGB proteins are recruited by and help facilitate the assembly of site-specific DNA binding proteins to their cognate binding sites in chromatin. For example, HMGB1 and HMGB2 facilitate the binding of Hox proteins, Oct proteins, p53, Rel proteins, and steroid hormone receptor proteins to their target gene promoters (11246022,14871457). Furthermore, HMGB2 interacts with RAG1 to facilitate RAG complex binding to the recombinant signal sequence (RSS) and stimulate DNA-bending and subsequent VDJ cleavage at antigen receptor genes (19317908 ,10490593). In addition to their functions in the nucleus, HMGB proteins play a significant role in extracellular signaling associated with inflammation. HMGB2 is secreted by myeloid cells and promotes proliferation and migration of endothelial cells by binding to the receptor for advanced glycation endproducts (RAGE) (19811285 ). Research studies have shown that HMGB2 overexpression in hepatocellular carcinoma is associated with poor prognosis and shorter survival time (20851854).This antibody recognizes the phosphorylation form of HMGB2 protein. The calculated molecular weight of HMGB2 is 24 kDa, but the post-modifiction of HMGB2 is about 33-35 kDa. (PMID: 18218727)

Protocols

Product Specific Protocols
WB protocol for HMGB2 antibody 14597-1-APDownload protocol
IHC protocol for HMGB2 antibody 14597-1-APDownload protocol
IF protocol for HMGB2 antibody 14597-1-APDownload protocol
IP protocol for HMGB2 antibody 14597-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouse

Front Immunol

Single-cell protein activity analysis reveals a novel subpopulation of chondrocytes and the corresponding key master regulator proteins associated with anti-senescence and OA progression

Authors - Zhao Guang
mouseWB

Ecotoxicol Environ Saf

Proteomic analysis reveals that cigarette smoke exposure diminishes ovarian reserve in mice by disrupting the CREB1-mediated ovarian granulosa cell proliferation-apoptosis balance

Authors - Mengting Xu
ratWB

Environ Pollut

Fluoride-induced unrestored arrest during haploid period of spermatogenesis via the regulation of DDX25 in rats.

Authors - Yongli Han
mouseWB

Chemosphere

Arsenic influences spermatogenesis by disorganizing the elongation of spermatids in adult male mice.

Authors - Yongli Han
humanWB

Cancer Gene Ther

The LncRNA RP11-301G19.1/miR-582-5p/HMGB2 axis modulates the proliferation and apoptosis of multiple myeloma cancer cells via the PI3K/AKT signalling pathway.

Authors - Faming Wang
humanWB

Cell Commun Signal

HMGB2 is associated with malignancy and regulates Warburg effect by targeting LDHB and FBP1 in breast cancer.

Authors - Deyuan Fu
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...