Tested Applications
| Positive WB detected in | HeLa cells, HAP1 cells, human heart tissue, mouse skeletal muscle tissue, Raji cells, MCF-7 cells, Jurkat cells, HEK-293 cells, SH-SY5Y cells, COS-7 cells, Neuro-2a cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human kidney tissue, human colon tissue, human thyroid tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
15775-1-AP targets HTRA2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat, monkey, chicken, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8455 Product name: Recombinant human HTRA2 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 133-458 aa of BC000096 Sequence: AAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE Predict reactive species |
| Full Name | HtrA serine peptidase 2 |
| Calculated Molecular Weight | 49 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC000096 |
| Gene Symbol | HTRA2 |
| Gene ID (NCBI) | 27429 |
| RRID | AB_2122835 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43464 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
HTRA2(High temperature requirement protein A2) is also named as OMI, PRSS25 and belongs to the peptidase S1B family. HTRA2 normally exists in the mitochondria, can cause MMP3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cells(PMID: 22265821). It inhibits mitochondrial superoxide generation, stabilizes mitochondrial membrane potential, and prevents apoptosis at baseline and in response to extracellular inducers of mitochondrial stress(PMID: 18772386). This protein has 4 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HTRA2 antibody 15775-1-AP | Download protocol |
| IP protocol for HTRA2 antibody 15775-1-AP | Download protocol |
| WB protocol for HTRA2 antibody 15775-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cell Rep TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria | ||
Int J Mol Sci The Mechanism of Mitochondrial Injury in Alpha-1 Antitrypsin Deficiency Mediated Liver Disease. | ||
Hum Mol Genet Multi-OMICS study of a CHCHD10 variant causing ALS demonstrates metabolic rewiring and activation of endoplasmic reticulum and mitochondrial unfolded protein responses. | ||
Cancer Sci Establishment of MAGEC2-knockout cells and functional investigation of MAGEC2 in tumor cells. | ||
Cancer Biomark Role of Smac, survivin, XIAP, and Omi/HtrA2 proteins in determining the chemotherapeutic response of patients with cervical cancer treated with neoadjuvant chemotherapy |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ziwei (Verified Customer) (01-04-2026) | works as it should be.
|
Ziwei (Verified Customer) (12-14-2025) | This antibody shows high specificity and sensitivity in Western blot applications.
|
Monifa (Verified Customer) (08-31-2025) | This antibody worked well for detecting HTRA2 levels in these cells. I do have to load >100ug of lysate as these cells are suspension and slow growing. But a 1:1000 dilution in 1% BSA, overnight 4C gave me good signal of this protein in whole cell lysates as well as in crude mitochondria isolated fractions.
|
Abigail (Verified Customer) (04-04-2024) | Reproducibly generates a clean, strong signal at ~36 kDa! Highly recommend!
|



























