Tested Applications
| Positive WB detected in | HEK-293 cells, HAP1 cells, rat liver tissue, HeLa cells, HepG2 cells, NIH/3T3 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12332-1-AP targets IDH1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, zebrafish, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2986 Product name: Recombinant human IDH1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 119-414 aa of BC012846 Sequence: RLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL Predict reactive species |
| Full Name | isocitrate dehydrogenase 1 (NADP+), soluble |
| Calculated Molecular Weight | 414 aa, 47 kDa |
| Observed Molecular Weight | 47 kDa |
| GenBank Accession Number | BC012846 |
| Gene Symbol | IDH1 |
| Gene ID (NCBI) | 3417 |
| RRID | AB_2123159 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75874 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IDH1, also named as PICD and IDP, belongs to the isocitrate and isopropylmalate dehydrogenases family. It is a common feature of a major subset of primary human brain cancers. It can form a homodimer(PMID:15173171). IDH1 mutation is always heterozygotic and IDH1 functions as a dimer, theoretically there will be 25% each wild type and mutant homo-dimers and 50% hetero-dimers present in the tumor cells(PMID:21079649 ).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IDH1 antibody 12332-1-AP | Download protocol |
| IF protocol for IDH1 antibody 12332-1-AP | Download protocol |
| IHC protocol for IDH1 antibody 12332-1-AP | Download protocol |
| IP protocol for IDH1 antibody 12332-1-AP | Download protocol |
| WB protocol for IDH1 antibody 12332-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-IDH1 monoclonal antibody (Cat# 12332-1-AP) has 79 total citations across journals including Nature, Cancer Cell, Cell Research, Cancer Discovery, Nature Communications, Nature Chemical Biology, PNAS, EMBO Reports, Cell Reports, and Oncogene. Research fields encompass oncology (IDH mutations, tumor suppression), cellular metabolism (TCA cycle, NADPH production), epigenetics (histone demethylation, hypermethylation), neurology (Alzheimer's, hearing loss), immunology (macrophage polarization, ferroptosis), liver disease, cardiology, and stem cell biology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Leukemic IDH1 and IDH2 mutations result in a hypermethylation phenotype, disrupt TET2 function, and impair hematopoietic differentiation. | ||
Nature IDH mutation impairs histone demethylation and results in a block to cell differentiation. |
Reviews
What customers say
The single review for 12332-1-AP is from Umut G., who used the antibody for Western Blot on U87MG cells at a 1:1000 dilution. They reported that it worked very well in a standard application with average exposure, giving it a 5-star rating. Overall, the feedback is positive, confirming reliable performance for WB under routine conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Umut (Verified Customer) (07-25-2023) | The antibody worked very well for Western Blot in a standard application with an average dilution and exposure.
 |
