IFIT1 Polyclonal antibody

• 

  WB analysis using 23247-1-AP

  untreated and IFN beta treated HeLa cells were subjected to SDS PAGE followed by western blot with 23247-1-AP (IFIT1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat kidney using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 23247-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 23247-1-AP (IFIT1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 23247-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using IFIT1 antibody (23247-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

IFIT1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 23247-1-AP

Publications(35)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

G10P1, IFI 56K, IFI56, IFI-56K, IFIT 1

---

Tested Applications

• Positive WB detected in: IFN beta treated HeLa cells
• Positive IHC detected in: mouse kidney tissue, human kidney tissue, mouse brain tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 32 publications below
• IHC: See 2 publications below
• IF: See 4 publications below
• CoIP: See 1 publications below

Product Information

23247-1-AP targets IFIT1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19691

  Product name: Recombinant human IFIT1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 340-460 aa of BC007091

  Sequence: EVAHLDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYY

• Full Name: interferon-induced protein with tetratricopeptide repeats 1
• Calculated Molecular Weight: 478 aa, 55 kDa
• Observed Molecular Weight: 55 KDa
• GenBank Accession Number: BC007091
• Gene Symbol: IFIT1
• Gene ID (NCBI): 3434
• RRID: AB_2811269
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P09914
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IFIT1, also known as glucocorticoid-attenuated response gene 16 protein (GARG-16), is a 463 amino acid protein belonging to the IFIT family. IFIT genes comprise a large family with three (IFIT1, IFIT2, and IFIT3) and four (IFIT1, IFIT2, IFIT3, and IFIT5) members in mice and humans, respectively. IFIT1 specifically bound virus PPP-RNA forms a complex with IFIT2 and IFIT3 to sequester the viral PPP-RNA and prevent virus replication.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion; Authors - Wenwen Zheng
human	IF	Adv Sci (Weinh); Single-Cell Transcriptomic Analysis of Primary and Metastatic Tumor Ecosystems in Esophageal Squamous Cell Carcinoma; Authors - Yongxu Jia
human	WB	Cancer Lett; Induction of IFIT1/IFIT3 and inhibition of Bcl-2 orchestrate the treatment of myeloma and leukemia via pyroptosis; Authors - Yuanming He ; KD Validated
human	WB	Int J Mol Sci; Rubella Virus Triggers Type I Interferon Antiviral Response in Cultured Human Neural Cells: Involvement in the Control of Viral Gene Expression and Infectious Progeny Production; Authors - Sayuri Sakuragi
human	WB	J Neuroinflammation; Progression of pathology in PINK1-deficient mouse brain from splicing via ubiquitination, ER stress, and mitophagy changes to neuroinflammation.; Authors - Sylvia Torres-Odio
human	WB,IHC	Cell Oncol (Dordr); IFIT1 modulates the proliferation, migration and invasion of pancreatic cancer cells via Wnt/β-catenin signaling.; Authors - Tian-Hao Li ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

MALLIKARJUNA (Verified Customer) (10-17-2025)

BEST FOR WB

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse tissue

FH

Christin (Verified Customer) (03-28-2023)

Very nice antibody for WB

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Human iPSC-derived macrophages and microglia