Tested Applications
| Positive WB detected in | MDA-MB-231 cells, OVCAR-3 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10189-2-AP targets IGFBP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0242 Product name: Recombinant human IGFBP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 134-291 aa of BC000013 Sequence: PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK Predict reactive species |
| Full Name | insulin-like growth factor binding protein 3 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa, 40-45 kDa |
| GenBank Accession Number | BC000013 |
| Gene Symbol | IGFBP3 |
| Gene ID (NCBI) | 3486 |
| RRID | AB_2123233 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17936 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Insulin-like growth factor binding protein-3 (IGFBP-3) contains a 27 amino acid putative signal sequence followed by a mature protein of 264 amino acids with 18 cysteine residues clustered near the N- and C-terminus. Accordingly, expression of the cloned IGFBP-3 cDNA in mammalian tissue culture cells results in secretion of the protein into the culture medium. IGFBP-3 shares high homology (33% amino acid identity) including conservation of all 18 cysteine residues with a smaller human IGF-binding protein (BP-28) identified in amniotic fluid. IGFBP-3 has one or more glycosylation sites with a protein core of ∼30 kDa. Western blots revealed that the 39-45 kDa IGFBP-3 fragment is a glycoprotein. (PMID: 23403918, PMID: 24926947, PMID: 19887447)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IGFBP3 antibody 10189-2-AP | Download protocol |
| WB protocol for IGFBP3 antibody 10189-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IGFBP3 Polyclonal antibody (catalog no. 10189-2-AP) has 55 citations. These appear in high-impact journals including Cell, Nature Genetics, Nature Communications, Theranostics, Advanced Science, Biomaterials, PNAS, and iScience, among others. Research fields span oncology (hepatocellular, colorectal, gastric, prostate, ovarian, and bladder cancers), embryology and development, metabolism and obesity, diabetes, cardiovascular disease, aging and senescence, wound healing, and immunology, with applications mainly in WB, IHC, and IF.
| Species | Application | Title |
|---|---|---|
Cell Continuous modeling of primate embryogenesis from totipotency to early organogenesis. | ||
Nat Genet Multi-ancestry genome-wide study identifies effector genes and druggable pathways for coronary artery calcification | ||
Nat Commun Airway immune profiles and therapeutic implications of IGF1 in eosinophilic granulomatosis with polyangiitis. | ||
Theranostics Differential effect of cancer-associated fibroblast-derived extracellular vesicles on cisplatin resistance in oral squamous cell carcinoma via miR-876-3p
| ||
Adv Sci (Weinh) Long Non-Coding RNA IGFRIL Couples with PTBP1 to Destabilize IGFBP3 mRNA to Promote the IGF1R-AKT-mTOR Axis and Hepatocellular Carcinoma |
Reviews
What customers say
The product received one review with a 5-star rating. The reviewer used the antibody for immunofluorescence on PC3 cells at a 1:100 dilution and included an image demonstrating the staining result. No written comments were provided, but the top rating and shared image indicate strong satisfaction with the antibody's performance in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Margarita (Verified Customer) (04-19-2023) |
 |
