Tested Applications
Positive WB detected in | mouse spleen tissue, Jurkat cells, rat spleen tissue |
Positive IP detected in | mouse spleen tissue |
Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 33 publications below |
IHC | See 9 publications below |
IF | See 9 publications below |
ELISA | See 1 publications below |
Product Information
23457-1-AP targets CD126/IL-6R alpha in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18263 Product name: Recombinant human IL-6R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-371 aa of BC132684 Sequence: PRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAG Predict reactive species |
Full Name | interleukin 6 receptor |
Calculated Molecular Weight | 468 aa, 52 kDa |
Observed Molecular Weight | 80 kDa |
GenBank Accession Number | BC132684 |
Gene Symbol | IL-6R alpha |
Gene ID (NCBI) | 3570 |
RRID | AB_2827428 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P08887 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R alpha has been found in human serum and urine (PMID: 2529343; 1545125).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
IHC protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
IP protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Signal Transduct Target Ther Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms | ||
Cancer Discov Loss of Optineurin Drives Cancer Immune Evasion via Palmitoylation-Dependent IFNGR1 Lysosomal Sorting and Degradation. | ||
J Med Virol Molecular and immune signatures, and pathological trajectories of fatal COVID-19 lungs defined by in situ spatial single-cell transcriptome analysis | ||
BMC Med Molecular landscape of atherosclerotic plaque progression: insights from proteomics, single-cell transcriptomics and genomics | ||
Acta Pharmacol Sin Exosomes derived from induced cardiopulmonary progenitor cells alleviate acute lung injury in mice | ||
Int J Biol Macromol A dual gene-activated dermal scaffolds loaded with nanocomposite particles expressing of VEGF and aFGF: Promoting wound healing by early vascularization |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Jianhua (Verified Customer) (04-02-2025) | works very well for western blot
|