ING1 Polyclonal antibody

ING1 Polyclonal Antibody for WB, ELISA
Cat No. 17921-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, human

Applications

WB, ELISA

ING1, Inhibitor of growth protein 1, p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, A375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17921-1-AP targets ING1 in WB, ELISA applications and shows reactivity with mouse, human samples.

Tested Reactivity mouse, human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12338

Product name: Recombinant human ING1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-279 aa of BC093942

Sequence: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR

Predict reactive species
Full Name inhibitor of growth family, member 1
Calculated Molecular Weight279aa,32 kDa; 422aa,47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC093942
Gene Symbol ING1
Gene ID (NCBI) 3621
RRIDAB_2878467
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UK53
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ING1, also inhibitor of growth protein 1, is a 422 amino acid protein, which contains 1 PHD-type zinc finger and belongs to the ING family. ING1 localizes in the nucleus and interacts with TP53. It exsits as varous isoforms and isoform 1 is a 47 kDa protein. Isoform 2 is a 33 kDa protein and expressed in all normal tissues, as well as in all breast cancer and melanoma cell lines examined. ING1 cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. It is implicated as a tumor suppressor gene.

Protocols

Product Specific Protocols
WB protocol for ING1 antibody 17921-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...