ING1 Polyclonal antibody

• 

  WB analysis of mouse liver using 17921-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 17921-1-AP (ING1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 17921-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 17921-1-AP (ING1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 17921-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 17921-1-AP (ING1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ING1 Polyclonal Antibody for WB, ELISA

Cat No. 17921-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse, human

Applications

WB, ELISA

Synonyms

ING1, Inhibitor of growth protein 1, p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a

---

Tested Applications

• Positive WB detected in: mouse liver tissue, A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17921-1-AP targets ING1 in WB, ELISA applications and shows reactivity with mouse, human samples.

• Tested Reactivity: mouse, human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12338

  Product name: Recombinant human ING1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-279 aa of BC093942

  Sequence: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR

• Full Name: inhibitor of growth family, member 1
• Calculated Molecular Weight: 279aa,32 kDa; 422aa,47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC093942
• Gene Symbol: ING1
• Gene ID (NCBI): 3621
• RRID: AB_2878467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UK53
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ING1, also inhibitor of growth protein 1, is a 422 amino acid protein, which contains 1 PHD-type zinc finger and belongs to the ING family. ING1 localizes in the nucleus and interacts with TP53. It exsits as varous isoforms and isoform 1 is a 47 kDa protein. Isoform 2 is a 33 kDa protein and expressed in all normal tissues, as well as in all breast cancer and melanoma cell lines examined. ING1 cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. It is implicated as a tumor suppressor gene.