Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IRF2 Polyclonal antibody

IRF2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

IRF 2, IRF-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for IRF2 in ?

Tested Applications

Positive WB detected inHeLa cells, COLO 320 cells, Jurkat cells, mouse colon tissue
Positive IP detected inJurkat cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12525-1-AP targets IRF2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3220

Product name: Recombinant human IRF2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-349 aa of BC015803

Sequence: MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC

Predict reactive species
Full Name IRF 2
Calculated Molecular Weight 349 aa, 39 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC015803
Gene Symbol IRF2
Gene ID (NCBI) 3660
RRIDAB_2296127
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14316
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IRF2, also known as IFN regulatory factor 2, which belongs to the IRF family. IRF2 specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the IFN consensus sequence (ICS)) and represses those genes. IRF2 also acts as an activator for several genes including H4 and IL7. IRF2 constitutively binds to the ISRE promoter to activate IL7. IRF2 is involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. The calculated molecular weight of IRF2 is 39 kDa, but post-modification of IRF2 is about 50 kDa (PMID: 17698501).

Protocols

Product Specific Protocols
IF protocol for IRF2 antibody 12525-1-APDownload protocol
IHC protocol for IRF2 antibody 12525-1-APDownload protocol
IP protocol for IRF2 antibody 12525-1-APDownload protocol
WB protocol for IRF2 antibody 12525-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IRF2 antibody (Cat# 12525-1-AP) has 13 citations published in journals including Cancer Letters, International Journal of Molecular Sciences, Translational Oncology, Journal of Dermatological Science, Journal of Inflammation Research, iScience, Clinical Immunology, Virology Journal, Journal of Medical Virology, Pathology Research & Practice, Journal of Immunology Research, and Genes & Genomics. Associated research fields span gastric cancer, glioma, cutaneous squamous cell carcinoma, nasopharyngeal carcinoma, acute myeloid leukemia, viral infections (ZIKV, dengue), macrophage inflammation, immunodeficiency, microglia activation, and diabetic neuropathic pain.

SpeciesApplicationTitle
humanWB,ChIP

Cancer Lett

Lnc-PLCB1 is stabilized by METTL14 induced m6A modification and inhibits Helicobacter pylori mediated gastric cancer by destabilizing DDX21

Authors - Mingjie Chang
chickenWB

Int J Mol Sci

Analysis of miRNA Expression Profiling of RIP2 Knockdown in Chicken HD11 Cells When Infected with Avian Pathogenic E. coli (APEC).

Authors - Hongyan Sun
humanWB

Transl Oncol

IRF2-ferroptosis related gene is associated with prognosis and EMT in gliomas

Authors - Shiao Tong
  • KD Validated
humanWB

J Inflamm Res

IRF2 Affects LPS- and IFN-γ-Induced Pro-Inflammatory Responses, Cell Viability, Migration and Apoptosis of Macrophages by Regulating IRG1

Authors - Ru-Xue Qin
humanWB,IHC

J Dermatol Sci

PMID: 31138473

Authors - Xiangzhi Li
  • KD Validated

iScience

Regulatory role of IRF2 in proliferation and invasion of nasopharyngeal carcinoma and its underlying mechanism.

Authors - Chaofen Zhao
Loading...
||
New chat

Able™

正在加载,请稍候...