IRF3 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• IRF3 Monoclonal antibody (66670-1-Ig)

IRF3 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66670-1-Ig

Clone No.1E6G8

Publications(51)

Host / Isotype

Mouse / IgG1

Reactivity

human and More (3)

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

1E6G8, interferon regulatory factor 3, IRF 3, IRF-3

• 

  WB analysis using 66670-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66670-1-Ig (IRF3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66670-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66670-1-Ig (IRF3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66670-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66670-1-Ig (IRF3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 66670-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66670-1-Ig (IRF3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 66670-1-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66670-1-Ig (IRF3 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66670-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66670-1-Ig (IRF3 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66670-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66670-1-Ig (IRF3 antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 66670-1-Ig

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 66670-1-Ig (IRF3 antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, A431 cells, THP-1 cells, MOLT-4 cells, HepG2 cells, Jurkat cells, Daudi cells, Karpas-422 cells, Ramos cells
• Positive IHC detected in: human spleen tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66670-1-Ig targets IRF3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27223

  Product name: Recombinant human IRF3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-452 aa of BC009395

  Sequence: MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCGGVMAPGPAVDQEARDGQGCAHVPQGLGRNGPGRGCLLPGEYCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGDLSPRSSWCASNPPVPHHLNQ

• Full Name: interferon regulatory factor 3
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC009395
• Gene Symbol: IRF3
• Gene ID (NCBI): 3661
• RRID: AB_2882024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q14653
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The virul-induced expression of interferon(IFN) genes in infected cells implicate in the interplay of several constitutively expressed and virus-activated transcription factors. A family of IFN regulatory factors(IRFs) have been shown to has a role in the transcription of IFN genes as well as IFN-stimulated genes. IRF3 is a novel key transcriptional regulator of type I IFN-dependent immune responses and involves in the innate immune response against DNA and RNA viruses, by binding to the promoters of IFN. It located in the cytoplasm of uninfected cells in an inactive form, and following viral infection, double-stranded RNA (dsRNA), or toll-like receptor (TLR) signaling, could be phosphorylated by IKBKE and TBK1 kinases. This induces a conformational change, leading to its dimerization, nuclear localization and association with CREB binding protein (CREBBP) to form dsRNA-activated factor 1 (DRAF1), a complex which activates the transcription of the type I IFN and ISG genes.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	J Hematol Oncol; Glutathione reductase deficiency potentiates the immunogenicity of ferroptosis and cuproptosis via amplified reactive oxygen species accumulation and cGAS-STING pathway activation; Authors - Xiaoyi Deng
mouse	WB	Immunity; Membrane integrity changes upon viral infection activate sphingomyelinase SMPDL3B to restrict cGAS-STING signaling via cGAMP degradation; Authors - Zhimeng Wang
		Nat Cancer; CDK10 suppresses nucleic acid sensors-mediated antitumor immunity; Authors - Gaoshan Xu
		Nat Immunol; E3 ligase RAD18 targets phosphorylated IRF3 to terminate IFNB1 transcription; Authors - Yiting Cai
		Cell Mol Immunol; Dynamic regulation of TBK1 lactylation shapes antiviral immune responses.; Authors - Yingchao Xie
mouse	WB	Bioact Mater; Targeting and reprogramming microglial phagocytosis of neutrophils by ginsenoside Rg1 nanovesicles promotes stroke recovery; Authors - Kaichao Hu