Tested Applications
| Positive WB detected in | A549 cells, 3T3-L1 cells, COS-7 cells, HeLa cells, human placenta tissue, Calu-1 cells, NIH/3T3 cells |
| Positive IHC detected in | human placenta tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10569-1-AP targets Integrin alpha-5/CD49e in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, monkey samples.
| Tested Reactivity | human, mouse, monkey |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0860 Product name: Recombinant human Integrin alpha-5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 749-1049 aa of BC008786 Sequence: FTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHQQKREAPSRSSASSGPQILKCPEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA Predict reactive species |
| Full Name | integrin, alpha 5 (fibronectin receptor, alpha polypeptide) |
| Calculated Molecular Weight | 115 kDa |
| Observed Molecular Weight | 135-150 kDa |
| GenBank Accession Number | BC008786 |
| Gene Symbol | Integrin alpha 5 |
| Gene ID (NCBI) | 3678 |
| RRID | AB_2130060 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08648 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin alpha 5 (ITGA5), belongs to the integrin alpha chain family, primarily binds to Integrin beta 1 (ITGB1) to form an α5β1 heterodimer (PMID: 33711961). Integrin α5β1 is a specific receptor of fibronectin through its arginine-glycine-aspartic acid (RGD) binding site (PMID: 19608542). Integrin α5β1 plays roles in cell adhesion, migration and matrix formation, and has emerged as an essential mediator in many human carcinomas (PMID: 33408483).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Integrin alpha-5/CD49e antibody 10569-1-AP | Download protocol |
| WB protocol for Integrin alpha-5/CD49e antibody 10569-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Integrin alpha-5/CD49e Polyclonal antibody (Cat# 10569-1-AP) has 67 citations spanning journals including Nature Communications, Advanced Materials, Cell Death & Disease, Biomaterials, Journal of Biological Chemistry, FASEB Journal, and Oncotarget. Research fields encompass oncology (gastric, lung, glioma, ovarian, breast, and pancreatic cancers), bone and tissue engineering, fibrosis (liver, pulmonary, intestinal), cardiovascular repair, diabetic wound healing, stem cell biology, drug delivery/nanotechnology, and immunology.
| Species | Application | Title |
|---|---|---|
Adv Mater Tracing Immunological Interaction in Trimethylamine N-Oxide Hydrogel-Derived Zwitterionic Microenvironment During Promoted Diabetic Wound Regeneration | ||
Nat Commun The CCL20-integrin α5β1 interaction enhances TGF-β/Smad signaling to promote fibroblast activation in pulmonary fibrosis. | ||
Nat Commun In situ osteogenic activation of mesenchymal stem cells by the blood clot biomimetic mechanical microenvironment | ||
J Nanobiotechnology The bone marrow mesenchymal stem cells derived migrasomes induced by Titania nanotubes surface serve as chemotaxis effect for osteogenesis. | ||
J Nanobiotechnology Mechanically tunable fiber-based hydrogel activates PIEZO1-integrin axis for enhanced bone repair. | ||
Adv Sci (Weinh) Injectable pH Responsive Conductive Hydrogel for Intelligent Delivery of Metformin and Exosomes to Enhance Cardiac Repair after Myocardial Ischemia-Reperfusion Injury |
Reviews
What customers say
The single review for this product is highly positive (5/5). The user validated the antibody in both Western Blot and Immunofluorescence. In WB, it produced a clear band at the expected molecular weight, with signal decreasing during adipocyte differentiation—consistent with published literature. In IF, it successfully labeled the endogenous protein at the cell surface, again matching reported results. Overall, the reviewer found the antibody reliable and consistent with published data across both applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Boyan (Verified Customer) (02-04-2019) | Excellent. In WB, it gives a protein band at the expected molecular weight, and this band was decreased during adipocyte differentiation, which is consistent with those reported in literature. In IF, it labels endogenous protein at the cell surface, as that reported in literature.
|
