CD11c Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD11c Polyclonal antibody (17342-1-AP)

CD11c Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 17342-1-AP

Publications(84)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CD11 antigen-like family member C, Integrin alpha X, Integrin alpha-X, ITGAX, Leu M5

• 

  WB analysis using 17342-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 17342-1-AP (CD11c/Integrin Alpha X antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human plasma using 17342-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 17342-1-AP (ITGAX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 17342-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17342-1-AP (CD11c/Integrin Alpha X antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 17342-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17342-1-AP (CD11c/Integrin Alpha X antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of human tonsillitis using 17342-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded human tonsillitis tissue using CD11c antibody (17342-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: THP-1 cells, human plasma
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: human tonsillitis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17342-1-AP targets CD11c in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11380

  Product name: Recombinant human CD11c/Integrin alpha X protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-352 aa of BC038237

  Sequence: NLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMA

• Full Name: integrin, alpha X (complement component 3 receptor 4 subunit)
• Calculated Molecular Weight: 1169 aa, 129 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC038237
• Gene Symbol: CD11c
• Gene ID (NCBI): 3687
• ENSEMBL Gene ID: ENSG00000140678
• RRID: AB_2129787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20702
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated α and β subunits. CD11c/Integrin alpha X is a 145-150 kDa type I transmembrane glycoprotein present on a variety of cells, including monocytes/macrophages, granulocytes, NK cells and dendritic cells. Integrin alpha X/beta 2 acts a receptor for fibrinogen and is important in monocyte adhesion and chemotaxis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Cancer Commun (Lond); Glutamine metabolic microenvironment drives M2 macrophage polarization to mediate trastuzumab resistance in HER2-positive gastric cancer; Authors - Xingbin Hu
	IF	Adv Sci (Weinh); Bioactive Glycyrrhizic Acid Ionic Liquid Self-Assembled Nanomicelles for Enhanced Transdermal Delivery of Anti-Photoaging Signal Peptides; Authors - Zhuxian Wang
	IHC	Acta Pharm Sin B; Celastrol targets adenylyl cyclase-associated protein 1 to reduce macrophages-mediated inflammation and ameliorates high fat diet-induced metabolic syndrome in mice.; Authors - Yuyu Zhu
		Biomaterials; Light-controlled oxygen production and collection for sustainable photodynamic therapy in tumor hypoxia.; Authors - Haoran Wang
human	IF	J Immunother Cancer; TSH-TSHR axis promotes tumor immune evasion.; Authors - Zhenghao Wu
		Bioact Mater; Photosynthetic microorganisms coupled photodynamic therapy for enhanced antitumor immune effect.; Authors - Haoran Wang