Tested Applications
| Positive WB detected in | K-562 cells, Jurkat cells, rat spleen tissue, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells, Ramos cells, Daudi cells |
| Positive IHC detected in | human breast cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66466-1-Ig targets JAK1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, rat, mouse samples.
| Tested Reactivity | human, rat, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17940 Product name: Recombinant human JAK1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 8-363 aa of BC132729 Sequence: EDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVIFYLSDREPLRLGSGEYTAEELCIRAAQACRISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTNDNEQSVWRHSPKKQKNGYEKKKIPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQDGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMNWFHSNDGGNVLYYEVMVTGNLGIQWRHKPNVVSVEKEKNKLKRKKLENKHKKDEEKNKIREEW Predict reactive species |
| Full Name | Janus kinase 1 (a protein tyrosine kinase) |
| Calculated Molecular Weight | 1154 aa, 133 kDa |
| Observed Molecular Weight | 133 kDa |
| GenBank Accession Number | BC132729 |
| Gene Symbol | JAK1 |
| Gene ID (NCBI) | 3716 |
| RRID | AB_2881834 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P23458 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Janus kinase 1(JAK1), is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. JAK1 is essential for signaling for certain type I and type II cytokines. JAK1 plays a critical role in initiating responses to multiple major cytokine receptor families. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for JAK1 antibody 66466-1-Ig | Download protocol |
| WB protocol for JAK1 antibody 66466-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The JAK1 Monoclonal antibody (3H7A8), catalog number 66466-1-Ig, has accumulated 135 citations across over 100 journals, including high-impact publications such as Cell, Nature Communications, Science Advances, Advanced Science, Cell Reports, Developmental Cell, Journal of Medicinal Chemistry, and Frontiers in Immunology. Key research fields encompass oncology (breast, liver, lung, gastric, and other cancers), JAK/STAT signaling pathways, immunology and inflammation, natural product drug discovery, neurology, liver disease, and dermatology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Cannabis suppresses antitumor immunity by inhibiting JAK/STAT signaling in T cells through CNR2. | ||
Cell Mol Immunol SENP6 restricts the IFN-I-induced signaling pathway and antiviral activity by deSUMOylating USP8 | ||
Mol Neurodegener Inflammatory signaling differentially changes chromatin accessibility and gene expression of the PD- associated kinase LRRK2 between human and mice. | ||
Nat Commun Proteome-wide ligandability maps of drugs with diverse cysteine-reactive chemotypes | ||
Cardiovasc Diabetol Targeting TFAM K76 acetylation attenuates mitochondrial dysfunction and kidney injury in diabetic kidney disease. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot at a 1:1000 dilution on human cell lines and reported positive results. One user gave 5 stars, praising great results on human cancer cells. The other gave 4 stars, noting the signal appeared at the expected molecular weight with very low non-specific staining and was proportional to lysate loading, though a relatively large amount of lysate was required. Overall, users find it reliable for WB with clean, specific signals in human samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jimmy (Verified Customer) (05-28-2025) | Great results for western blot
|
Christine (Verified Customer) (07-12-2022) | Signal is at the expected molecular weight, very low aspecific staining on the membrane, signal is proportional to the lysate quantity loaded. Need quite a large quantity of lysates.
 |
