ATG13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ATG13 Polyclonal antibody (18258-1-AP)

• Featured Product
• KD/KO Validated

ATG13 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 18258-1-AP Copied!

Publications (30)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ATG13, Autophagy related protein 13, KIAA0652

• 

  WB analysis of SH-SY5Y using 18258-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18258-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 18258-1-AP

  WB result of ATG13 antibody (18258-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ATG13 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of BGC-823 using 18258-1-AP

  BGC-823 cells were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 18258-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse cerebellum using 18258-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 18258-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse thymus using 18258-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 18258-1-AP (ATG13 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of SH-SY5Y using 18258-1-AP

  IP result of anti-ATG13 (IP:18258-1-AP, 4ug; Detection:18258-1-AP 1:300) with SH-SY5Y cells lysate 1600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 18258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 18258-1-AP (ATG13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 18258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 18258-1-AP (ATG13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18258-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 18258-1-AP (ATG13 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 18258-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 18258-1-AP (ATG13 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 18258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18258-1-AP (ATG13 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 18258-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 18258-1-AP (ATG13 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 18258-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using 18258-1-AP (ATG13 antibody) at dilution of 1:50 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ATG13 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, BGC-823 cells, HeLa cells, human brain tissue, mouse cerebellum tissue, mouse testis tissue, mouse thymus tissue, Jurkat cells, HEK-293 cells, MCF-7 cells
• Positive IP detected in: SH-SY5Y cells
• Positive IHC detected in: mouse heart tissue, mouse brain tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18258-1-AP targets ATG13 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13090

  Product name: Recombinant human KIAA0652 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 131-481 aa of BC001331

  Sequence: ITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ*

• Full Name: KIAA0652
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57-63 kDa
• GenBank Accession Number: BC001331
• Gene Symbol: ATG13
• Gene ID (NCBI): 9776
• RRID: AB_2130658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75143
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG13 is one component protein of the ULK1 complex which is required for autophagosome formation and mitophagy. ATG13 has two nutrient regulatory phosphorylation sites and the phosphorylation status of ATG13 affect regulation of autophagy by modulating enzyme activity and cellular localization of ULK1. Besides, it has been reported the nonautophagic function of ATG13 on cardiac development for ATG13-deficient embryos show myocardial growth defects.(PMID:27387056, 26801615, 26644405)

Publications

What published studies show

ATG13 Antibody (Cat# 18258-1-AP) has 30 citations published in journals including Cell, Nature Communications, Nature Biomedical Engineering, Autophagy, JCI, EMBO Reports, and Journal of Biological Chemistry. Research fields span autophagy regulation, neurodegeneration, cancer biology, diabetes, inflammation, mitochondrial function, and viral infection, with applications primarily in Western blot, immunofluorescence, and co-immunoprecipitation.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Cell; Noncanonical autophagy promotes the visual cycle.; Authors - Kim Ji-Young JY ; KD Validated
human	WB,CoIP	Mil Med Res; Intracellular accumulation of tau inhibits autophagosome formation by activating TIA1-amino acid-mTORC1 signaling.; Authors - Meng-Zhu Li
human	WB	Nat Biomed Eng; A deep learning and large language hybrid workflow for omics interpretation.; Authors - Dachao Tang
mouse		Autophagy; The ALS-FTD-linked gene product, C9orf72, regulates neuronal morphogenesis via autophagy.; Authors - Wan Yun Ho
	WB,IF	Autophagy; S-palmitoylation coordinates the trafficking of ATG9A to mediate autophagy initiation; Authors - Fan Xia
human, mouse	WB	Nat Commun; Acetylation of STX17 promotes its autophagosomal translocation.; Authors - Chenqian Zhou