• Featured Product
  • KD/KO Validated

KLF4 Polyclonal antibody

KLF4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 11880-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, chIP, ELISA

EZF, GKLF, Krueppel like factor 4, Krueppel-like factor 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, A549 cells, HUVEC cells, NCCIT cells, HEK-293 cells, HT-29 cells, C2C12 cells, HT-1080 cells, HeLa cells, mouse liver tissue, mouse lung tissue
Positive IP detected inHeLa cells
Positive IHC detected inmouse embryo tissue, human tonsil tissue, human spleen tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inhuman embronic stem cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11880-1-AP targets KLF4 in WB, IHC, IF/ICC, FC (Intra), IP, chIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2480

Product name: Recombinant human KLF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 204-504 aa of BC030811

Sequence: IPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

Predict reactive species
Full Name Kruppel-like factor 4 (gut)
Calculated Molecular Weight 504 aa, 54 kDa
Observed Molecular Weight 50-60 kDa
GenBank Accession NumberBC030811
Gene Symbol KLF4
Gene ID (NCBI) 9314
RRIDAB_10640807
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43474
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian Krüppel-like transcription factor 4 (Klf4) is an evolutionarily conserved zinc finger-containing transcription factor with diverse regulatory functions in cell growth, proliferation, differentiation and embryogenesis. It also plays a significant role in the process of tumorigenesis. Klf4 is one of the key transcription factors that have been used to reprogram mouse and human fibroblasts to a pluripotent state also called induced pluripotent stem (iPS) cells. Affinity purified rabbit anti- Klf4 is for the detection of Klf4 transgene expression in the process of reprogramming. There are two isoforms of KLF4 (PMID: 15561714), with MW range from 50 to 60 kDa,and major band is 55 kDa. KLF4 protein can be ubiquitin modified.

Protocols

Product Specific Protocols
FC protocol for KLF4 antibody 11880-1-APDownload protocol
IHC protocol for KLF4 antibody 11880-1-APDownload protocol
IP protocol for KLF4 antibody 11880-1-APDownload protocol
WB protocol for KLF4 antibody 11880-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Metab

Maternal exercise prevents metabolic disorders in offspring mice through SERPINA3C

Authors - Yang Li
mouseWB,IF

Nat Commun

Klf4 glutamylation is required for cell reprogramming and early embryonic development in mice.

Authors - Buqing Ye
humanWB,IHC

Nat Commun

LncBRM initiates YAP1 signalling activation to drive self-renewal of liver cancer stem cells.

Authors - Pingping Zhu
humanWB

J Exp Clin Cancer Res

FOLR2+ macrophage depletion from intestinal metaplasia to early gastric cancer: single-cell sequencing insight into gastric cancer progression

Authors - Yuxin He
humanWB,IHC

J Hematol Oncol

A novel lncRNA ROPM-mediated lipid metabolism governs breast cancer stem cell properties.

Authors - Shuiqing Liu
humanIF

Mater Today Bio

Cellular reprogramming with multigene activation by the delivery of CRISPR/dCas9 ribonucleoproteins via magnetic peptide-imprinted chitosan nanoparticles.

Authors - Mei-Hwa Lee
Loading...
||
New chat Able
正在加载,请稍候...