Tested Applications
| Positive WB detected in | A431 cells, A549 cells, HUVEC cells, NCCIT cells, HEK-293 cells, HT-29 cells, C2C12 cells, HT-1080 cells, HeLa cells, mouse liver tissue, mouse lung tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse embryo tissue, human tonsil tissue, human spleen tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | human embronic stem cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11880-1-AP targets KLF4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2480 Product name: Recombinant human KLF4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-504 aa of BC030811 Sequence: IPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF Predict reactive species |
| Full Name | Kruppel-like factor 4 (gut) |
| Calculated Molecular Weight | 504 aa, 54 kDa |
| Observed Molecular Weight | 50-60 kDa |
| GenBank Accession Number | BC030811 |
| Gene Symbol | KLF4 |
| Gene ID (NCBI) | 9314 |
| RRID | AB_10640807 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43474 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The mammalian Krüppel-like transcription factor 4 (Klf4) is an evolutionarily conserved zinc finger-containing transcription factor with diverse regulatory functions in cell growth, proliferation, differentiation and embryogenesis. It also plays a significant role in the process of tumorigenesis. Klf4 is one of the key transcription factors that have been used to reprogram mouse and human fibroblasts to a pluripotent state also called induced pluripotent stem (iPS) cells. Affinity purified rabbit anti- Klf4 is for the detection of Klf4 transgene expression in the process of reprogramming. There are two isoforms of KLF4 (PMID: 15561714), with MW range from 50 to 60 kDa,and major band is 55 kDa. KLF4 protein can be ubiquitin modified.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for KLF4 antibody 11880-1-AP | Download protocol |
| IHC protocol for KLF4 antibody 11880-1-AP | Download protocol |
| IP protocol for KLF4 antibody 11880-1-AP | Download protocol |
| WB protocol for KLF4 antibody 11880-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The KLF4 Polyclonal antibody (Cat# 11880-1-AP) has 233 total citations. Publications appear in high-impact journals including Nature Communications, Cell Stem Cell, Nature Metabolism, Cancer Cell, Molecular Cell, Theranostics, Journal of Clinical Investigation, Cell Reports, EMBO Journal, and Science Advances. Research fields span oncology (cancer stem cells, hepatocellular carcinoma, breast cancer), cardiovascular biology (atherosclerosis, aortic aneurysm), stem cell pluripotency, fibrosis, neuroinflammation, immunology, and toxicology.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Krüppel-like factor 4 downregulation during esophageal cancer formation facilitates immune evasion and impairs immunotherapy | ||
Cancer Cell Epithelial cells activate fibroblasts to promote esophageal cancer development | ||
J Hematol Oncol A novel lncRNA ROPM-mediated lipid metabolism governs breast cancer stem cell properties. | ||
Adv Mater Safeguarding VSMC Contractile Phenotype With In Situ circRNA-mediated Endothelial Olaratumab Engineering to Prevent Vascular Graft Stenosis. | ||
Nat Metab Maternal exercise prevents metabolic disorders in offspring mice through SERPINA3C | ||
