LDLR Monoclonal antibody

• Home
• Products
• Primary Antibodies
• LDLR Monoclonal antibody (66414-1-Ig)

• Featured Product
• KD/KO Validated

LDLR Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66414-1-Ig Copied!

Clone No. 1A2A3

Publications (19)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

1A2A3, FH, FHC, LDL receptor

• 

  WB analysis of HeLa using 66414-1-Ig

  WB result of LDLR antibody (66414-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-LDLR transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66414-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66414-1-Ig (LDLR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66414-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66414-1-Ig (LDLR Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66414-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66414-1-Ig (LDLR Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66414-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66414-1-Ig (LDLR Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66414-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66414-1-Ig (LDLR Antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66414-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66414-1-Ig (LDLR Antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for LDLR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, HepG2 cells, MCF-7 cells, Raji cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:15000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66414-1-Ig targets LDLR in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, hamster
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1236

  Product name: Recombinant human LDLR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC014514

  Sequence: MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQR

• Full Name: low density lipoprotein receptor
• Calculated Molecular Weight: 95 kDa
• Observed Molecular Weight: 100-160 kDa
• GenBank Accession Number: BC014514
• Gene Symbol: LDLR
• Gene ID (NCBI): 3949
• ENSEMBL Gene ID: ENSG00000130164
• RRID: AB_2881786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P01130
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

LDLR (low density lipoprotein receptor) is a member of the LDL receptor gene family and is involved in receptor-mediated endocytosis of specific ligands. The LDLR is a cell surface glycoprotein that scavenges LDL from the blood and regulates plasma LDL cholesterol. The cytoplasmic domain of the LDL receptor is necessary for the receptor to cluster in coated pits, which promotes the rapid endocytosis of bound LDL. The protein is highly glycosylated through N- and O-linkages and thus migrates at 100 to 160 kDa bands on SDS-PAGE.

Publications

What published studies show

The LDLR Monoclonal antibody (1A2A3), catalog number 66414-1-Ig, has 19 citations. These appear in journals including Nature Nanotechnology, Nature Protocols, Nature Communications, Research, Acta Pharmacologica Sinica, International Journal of Molecular Medicine, JCI Insight, Journal of Agricultural and Food Chemistry, European Journal of Medicinal Chemistry, Biochemical Pharmacology, FASEB Journal, and others. Research fields span lipid/cholesterol metabolism, cardiovascular disease, cancer, diabetes, viral infection, and gene delivery.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Nanotechnol; Nanoparticles for inducing Gaucher disease-like damage in cancer cells; Authors - Chunyan Yue ; KD Validated
human	WB,IHC,ELISA	Nat Protoc; Receptor discovery for nanomaterial soft and hard coronas via a biosensor-based Fishing strategy.; Authors - Didar Baimanov
		Nat Commun; Accurate profiling of single-cell alternative transcript start sites by correcting RNA degradation.; Authors - Zijie Xu
	WB,IF	Research (Wash D C); Targeting ApoE-KCC2 Signaling Rescues GABAergic Synaptic Dysfunction and Depression-like Behaviors in Mice; Authors - Chengyuan Xu
human	WB	Research (Wash D C); Large-Scale CRISPR Screen of LDLR Pathogenic Variants; Authors - Mengjing Li
human	WB	Acta Pharmacol Sin; AMPK activator C24 inhibits hepatic lipogenesis and ameliorates dyslipidemia in HFHC diet-induced animal models.; Authors - Shui-Mei Sun