LRDD Polyclonal antibody

• Home
• Products
• Primary Antibodies
• LRDD Polyclonal antibody (12119-1-AP)

LRDD Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12119-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

PIDD-C, PIDD1, PIDD, p53-induced death domain-containing protein 1, Leucine-rich repeat and death domain-containing protein

• 

  WB analysis using 12119-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12119-1-AP (LRDD antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of L02 using 12119-1-AP

  IP result of anti-LRDD (IP:12119-1-AP, 4ug; Detection:12119-1-AP 1:500) with L02 cells lysate 2800ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 12119-1-AP (LRDD antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 12119-1-AP (LRDD antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 12119-1-AP (LRDD antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12119-1-AP (LRDD antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12119-1-AP (LRDD antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 12119-1-AP (LRDD antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 12119-1-AP (LRDD antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 12119-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 12119-1-AP (LRDD antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 12119-1-AP

  Immunofluorescent analysis of Hela cells, using LRDD antibody 12119-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 12119-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using LRDD antibody (12119-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, L02 cells
• Positive IP detected in: L02 cells
• Positive IHC detected in: human lung tissue, human pancreas tissue, human liver tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12119-1-AP targets LRDD in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2761

  Product name: Recombinant human LRDD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC014904

  Sequence: MAATVEGPELEAAAAAGDASEDSDAGSRALPFLGGNRLSLDLYPGGCQQLLHLCVQQPLQLLQVEFLRLSTHEDPQLLEATLAQLPQSLSCLRSLVLKGGQRRDTLGACLRGALTNLPAGLSGLAHLAHLDLSFNSLETLPACVLQMRGLGALLLSHNCLSELPEALGALPALTFLTVTHNRLQTLPPALGALSTLQRLDLSQNLLDTLPPEIGGLGSLLELNLASNRLQSLPASLAGLRSLRLLVLHSNLLASVPADLARLPLLTRLDLRDNQLRDLPPELLDAPFVRLQGNPLGEASPDAPSSPVAALIPEMPRLFLTSDLDSFPVTPRGCSVTLACGVRLQFPAGAT

• Full Name: leucine-rich repeats and death domain containing
• Calculated Molecular Weight: 893 aa, 98 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC014904
• Gene Symbol: LRDD
• Gene ID (NCBI): 55367
• RRID: AB_10694424
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9HB75
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

P53-induced protein with a death domain (PIDD/LRDD) is a component of the PIDDosome. PIDD contains 910 residues with 7 leucine rich repeats (LRRs), 2 ZU-5 domains and a C-terminal death domain (DD). PIDD can be cleaved into shorter fragments generating a PIDD-N fragment of 48 kD (residues 1-446), a PIDD-C fragment of 51 kD (residues 447-910) and a PIDD-CC fragment of 37 kD (residues 589-910). Auto-cleavage of PIDD determines the downstream signaling events. The PIDD-C fragment mediates activation of NFκB via the recruitment of RIP1 and NEMO, while PIDD-CC causes caspase-2 activation, which leads to apoptosis.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Neural Regen Res; Neat1 decreases neuronal apoptosis after oxygen and glucose deprivation.; Authors - Wei-Na Chai
mouse	WB	Exp Neurol; Microglia aggravate white matter injury via C3/C3aR pathway after experimental subarachnoid hemorrhage; Authors - Lei Yang