Tested Applications
Positive WB detected in | MCF-7 cells, mouse liver tissue, pig heart tissue, mouse heart tissue, rat heart tissue |
Positive IHC detected in | human liver tissue, mouse heart tissue, mouse brown adipose tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 23 publications below |
IHC | See 2 publications below |
IF | See 5 publications below |
IP | See 1 publications below |
Product Information
26951-1-AP targets Perilipin 5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Cited Reactivity | human, mouse, rat, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25272 Product name: Recombinant human LSDP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-463 aa of BC131524 Sequence: ILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF Predict reactive species |
Full Name | lipid storage droplet protein 5 |
Calculated Molecular Weight | 463 aa, 51 kDa |
Observed Molecular Weight | 51-55 kDa |
GenBank Accession Number | BC131524 |
Gene Symbol | Perilipin 5 |
Gene ID (NCBI) | 440503 |
RRID | AB_2880699 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q00G26 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Perilipin 5 (also known as LSDP5/OXPAT) is a lipid droplet (LD) coat protein that promotes association of LDs with mitochondria and is mainly present in tissues with a high fat-oxidative capacity, such as heart, skeletal muscles and brown adipose tissue. It plays an important role in the regulation of cardiac lipid storage and function.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Perilipin 5 antibody 26951-1-AP | Download protocol |
IHC protocol for Perilipin 5 antibody 26951-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Mol Cell Biol Knockdown of hepatocyte Perilipin-3 mitigates hepatic steatosis and steatohepatitis caused by hepatocyte CGI-58 deletion in mice | ||
EMBO Rep miR-183 and miR-96 orchestrate both glucose and fat utilization in skeletal muscle. | ||
Int J Mol Sci Effects of Simvastatin on Lipid Metabolism in Wild-Type Mice and Mice with Muscle PGC-1α Overexpression. | ||
Int Immunopharmacol Perilipin 5 protects against oxygen-glucose deprivation/reoxygenation-elicited neuronal damage by inhibiting oxidative stress and inflammatory injury via the Akt-GSK-3β-Nrf2 pathway. | ||
Hum Cell Aryl hydrocarbon receptor promotes lipid droplet biogenesis and metabolic shift in respiratory Club cells. | ||
Biochem Biophys Res Commun Perilipin 5 ameliorates high-glucose-induced podocyte injury via Akt/GSK-3β/Nrf2-mediated suppression of apoptosis, oxidative stress, and inflammation. |