Tested Applications
| Positive WB detected in | LNCaP cells, human placenta tissue |
| Positive IP detected in | LNCaP cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 24 publications below |
| IHC | See 9 publications below |
| IF | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
10539-1-AP targets MAOA in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0821 Product name: Recombinant human MAOA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 242-527 aa of BC008064 Sequence: HPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS Predict reactive species |
| Full Name | monoamine oxidase A |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | BC008064 |
| Gene Symbol | MAOA |
| Gene ID (NCBI) | 4128 |
| RRID | AB_2137251 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P21397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MAOA belongs to the flavin monoamine oxidase family. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MAOA antibody 10539-1-AP | Download protocol |
| IP protocol for MAOA antibody 10539-1-AP | Download protocol |
| WB protocol for MAOA antibody 10539-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution | ||
Sci Adv Global ubiquitylation analysis of mitochondria in primary neurons identifies endogenous Parkin targets following activation of PINK1. | ||
J Clin Invest A pro-tumorigenic secretory pathway activated by p53 deficiency in lung adenocarcinoma. | ||
J Hepatol Monoamine oxidase A suppresses hepatocellular carcinoma metastasis by inhibiting the adrenergic system and its transactivation of EGFR signaling. |

















